Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52V1P Olfactory Receptor

Gene Symbol OR52V1P1 (View this gene in GeneCards)
Family 52
Subfamily V
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-44, HsOR11.3.69P, ORL3612
External Ids HGNC: 15238   GeneBank: BK004732, NG_004216   ORDB: ORL3612   
Build #39 labels OR52V1P
Chromosomal location 11:5,527,223-5,528,126 (-)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52B2 45.45% 286
OR52B6 43.48% 299
OR52D1 46.49% 299

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52V2 74% 286
Chimp CONTIG465.60-28648 95% 302
Mouse Or52z1 46% 286
Rat Or52z1 46% 286
Cow OR52V2P 65% 294

Sequence information

Nucleotide sequence ATGCCGGGACTGGAGGCTCTGCATGCCTGGCTCTCTGTGCTTGTGTGCCTGCTCTACATG
GCAGCTTTGGTAGGGAATGCCCTTCTAGTGGGGCTGGTGGTCACTGACAAGGCACTCTGG
GCACCCATGTACCAGCTGCTGTGGCTTCTGGCAGCTGCTGATTTTGTTCTGGCCACATCC
ACAGTGCCCAAAGCTCTGGCTGTACTTTGGGGCTTGTCTAGTGAGATATCATTTGGAGGC
TGCTTGGCTCAACTCTTTGTTGCCCATGTGTCAATCATTGCCACATTGCTGAGTCCTCAG
TGCTGCTGTCCACGGCCGTAGACTGCCAGCCTTTGCGCTATGGGGCGTTGCTGGCCCAGT
TTGTGGTAGGTCTAGTGGCTCTGACTACCATGACCCGTGATGTCTGTGTCATGTACACCC
TGTGATCCTGTTCAAGAAACTGCCTTACTGTGGACAGTGGGCCCTGCCCCACACCTACTG
CGAACACATGGGTGTGGCTTGCCTGGCATGTGGAGATACGTGCCCCATCATCAGGTATGG
ACTGGCCACCACACTGCTCTCCCCAGCCCTGGACCTAGGGCTCATAGGTGCTTCCTATGC
CCTCATTTTCCGTGCTGTCTGCCGTCTGCCATCCCATGTTGCCTGCCACAAGGCTCTGGG
TAACTGCGGGACCTATGCTAGCATCATTGGTCTCTTCTACACACCTGCCCTCTTCTCCTT
CCTTGCTCACTGTTTTGGGTGTCACACAGTGCCCAACCATATTCACATCCTACTGGCTAA
CCTCTACGCAGTGGTGTTCCCAGCTTTCAATCCTGTGGTCTATGGAGTGCAGACTCAGCA
GAGCTCAGAGGCTCAGGAACTTGCTTCAACTTTTCTGGGCAGGAGCAGTGAAGAAGGTTG
GCCC
Conceptual translation MPGLEALHAWLSVLVCLLYMAALVGNALLVGLVVTDKALWAPMYQLLWLLAAADFVLATS
TVPKALAVLWGLSSEISFGGCLAQLFVAHVSIIATLLSPQCCC/TAVDCQPLRYGALLA
QFVVGLVALTTMTRDVCVMYT/VILFKKLPYCGQWALPHTYCEHMGVACLACGDTCPII
RYGLATTLLSPALDLGLIGASYALIFRAVCRLPSHVACHKALGNCGTYASIIGLFYTPAL
FSFLAHCFGCHTVPNHIHILLANLYAVVFPAFNPVVYGVQTQQSSEAQELASTFLGRSSE
EGWP

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP C/T 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 5,527,594 5,527,594 SNP T/A 1000GP (CEU, CHBJPT)
11 5,527,669 5,527,669 SNP A/G 1000GP (CEU, CHBJPT)
11 5,527,736 5,527,736 SNP A/G 1000GP (CEU, CHBJPT)
11 5,527,743 5,527,743 SNP T/C 1000GP (CEU, CHBJPT)
11 5,528,024 5,528,024 SNP T/C 1000GP (CEU, CHBJPT)
11 5,528,046 5,528,046 SNP G/A 1000GP (CEU)
11 5,528,086 5,528,086 SNP A/G 1000GP (CEU, CHBJPT)
11 5,548,824 5,548,824 SNP A/T rs12364340 (DbSNP)
11 5,548,899 5,548,899 SNP A/G rs10838265 (DbSNP)
11 5,548,973 5,548,973 SNP C/T rs61892124 (DbSNP)
11 5,549,254 5,549,254 SNP T/C rs1498480 (DbSNP)
11 5,549,316 5,549,316 SNP G/A rs1846317 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 5,505,764 6,194,475 CopyNumber Variation_34458 (DGV)
11 5,546,453 5,549,456 CopyNumber #123 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.