Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52W1 Olfactory Receptor

Gene Symbol OR52W11 (View this gene in GeneCards)
Family 52
Subfamily W
Pseudogene No
CORP pseudogene probability score 0.13 (functional)
Aliases OR11-71, HsOR11.3.102
External Ids HGNC: 15239   GeneBank: AB065511, BK004399, NM_001005178   
Build #39 labels OR52W1P
Chromosomal location 11:6,199,224-6,200,183 (+)
Cluster 11@6
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52D1 46.91% 307
OR52L1 51.34% 298
OR52L2P 49.83% 303

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52W1 86% 320
Chimp CONTIG*********** 52% 301
Chimp CONTIG784.96-2 98% 160
Mouse Or52w1 80% 318
Rat Or52w1 79% 318
Cow OR52W1 88% 318

Expression evidences

Source Accession
mRNA BC137225

Sequence information

Nucleotide sequence ATGGCAGAAACTCTACAACTCAATTCCACCTTCCTACACCCAAACTTCTTCATACTGACT
GGCTTTCCAGGGCTAGGAAGTGCCCAGACTTGGCTGACACTGGTCTTTGGGCCCATTTAT
CTGCTGGCCCTGCTGGGCAATGGAGCACTGCCGGCAGTGGTGTGGATAGACTCCACACTG
CACCAGCCCATGTTTCTACTGTTGGCCATCCTGGCAGCCACAGACCTGGGCTTAGCCACA
TCTATAGCCCCAGGGTTGCTGGCTGTGCTGTGGCTTGGGCCCCGATCTGTGCCATATGCT
GTGTGCCTGGTCCAGATGTTCTTTGTACATGCACTGACTGCCATGGAATCAGGTGTGCTT
TTGGCCATGGCCTGTGATCGTGCTGCGGCAATAGGGCGTCCACTGCACTACCCTGTCCTG
GTCACCAAAGCCTGTGTGGGTTATGCAGCCTTGGCCCTGGCACTGAAAGCTGTGGCTATT
GTTGTACCTTTCCCACTGCTGGTGGCAAAGTTTGAGCACTTCCAAGCCAAGACCATAGGC
CATACCTATTGTGCACACATGGCAGTGGTAGAACTGGTGGTGGGTAACACACAGGCCACC
AACTTATATGGTCTGGCACTTTCACTGGCCATCTCAGGTATGGATATTCTGGGTATCACT
GGCTCCTATGGACTCATTGCCCATGCTGTGCTGCAGCTACCTACCCGGGAGGCCCATGCC
AAGGCCTTTGGTACATGTAGTTCTCACATCTGTGTCATTCTGGCCTTCTACATACCTGGT
CTCTTCTCCTACCTCACACACCGCTTTGGTCATCACACTGTCCCAAAGCCTGTGCACATC
CTTCTCTCCAACATCTACTTGCTGCTGCCACCTGCCCTCAACCCCCTCATCTATGGGGCC
CGCACCAAGCAGATCAGAGACCGACTCCTGGAAACCTTCACATTCAGAAAAAGCCCGTTG
Conceptual translation MAETLQLNSTFLHPNFFILTGFPGLGSAQTWLTLVFGPIYLLALLGNGALPAVVWIDSTL
HQPMFLLLAILAATDLGLATSIAPGLLAVLWLGPRSVPYAVCLVQMFFVHALTAMESGVL
LAMACDRAAAIGRPLHYPVLVTKACVGYAALALALKAVAIVVPFPLLVAKFEHFQAKTIG
HTYCAHMAVVELVVGNTQATNLYGLALSLAISGMDILGITGSYGLIAHAVLQLPTREAHA
KAFGTCSSHICVILAFYIPGLFSYLTHRFGHHTVPKPVHILLSNIYLLLPPALNPLIYGA
RTKQIRDRLLETFTFRKSPL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS T/C L/P 1000GP (YRI, YRI, YRI, YRI)
11 100 -100 SYN C/T A/A 1000GP (YRI, YRI)
11 6,199,707 6,199,707 NS G/T V/L 1000GP (CHBJPT)
11 6,199,939 6,199,939 NS A/G H/R 1000GP (CEU, CHBJPT)
11 6,199,984 6,199,984 NS T/A L/Q 1000GP (CEU, CHBJPT)
11 6,200,019 6,200,019 NS A/G T/A 1000GP (CEU)
11 6,220,870 6,220,869 Ins(1) -/T rs34411693 (DbSNP)
11 6,221,169 6,221,169 NS A/G H/R rs10839531 (DbSNP)
11 6,221,179 6,221,179 SYN C/T A/A rs74053127 (DbSNP)
11 6,221,196 6,221,196 NS C/T S/F rs73392966 (DbSNP)
11 6,221,214 6,221,214 NS A/T Q/L rs11040799 (DbSNP)
11 6,221,249 6,221,249 NS A/G T/A rs325609 (DbSNP)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

P51L L87P H239R L254Q T266A R308Q % Freq CORP
1 P L R Q T R 60.06 0.098
2 P L H L T R 23.66 0.082
3 P L R L T R 8.53 0.098
4 P L H L A R 6.22 0.082
5 P P R L T R 0.61 0.076
6 L L H L T R 0.38 0.082
7 P L R L T Q 0.23 0.098
8 P L R Q T Q 0.23 0.098
9 P L H Q T R 0.08 0.082

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR52W1.aApr07-unspliced main_exon CDS chr11 6,199,224 6,200,183 +
3UTR chr11 6,200,183 6,200,186 +