Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52X1P Olfactory Receptor

Gene Symbol OR52X1P1 (View this gene in GeneCards)
Family 52
Subfamily X
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-73, HsOR11.3.97P, ORL3494
External Ids HGNC: 14790   GeneBank: BK004556, NG_002220   ORDB: ORL3494   
Build #39 labels OR52X1P
Chromosomal location 11:6,066,846-6,067,792 (-)
Cluster 11@6
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52K1 47.91% 311
OR52N4 47.88% 307
OR52S1P 48.04% 306

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52X1 86% 314
Chimp CONTIG465.5-222 95% 232
Mouse Or52x1 82% 315
Rat Or52x1 82% 313
Cow OR52X1P 81% 312

Expression evidences

Source Accession
ESTs BE148368

Sequence information

Nucleotide sequence TTTTTTTCCAATAATTCTGTTCTCTTCCCACATACTTTCTTCCTGGCTGGCATCCCAGGA
TTGACTGCCACCCACATTTGGATCTCACTTCCCTTTTGCTTTATGTTTTTCCTGTCATTG
ACTGGGAATGGTGTCCTGCTTTTTCTCATCCGGACAGAATGCAGCCTTCGCCAGCCCATG
TTTCTTTTTCTTGCCATGCTCTCCTTTGTCGACTTGGTCCTCTCTCTCTCCACACTGCCT
AAGATGCTGGCCATTTTCTGGTTTGGTGCTACAGCCATCAGCTCGCATTCCTGTCTTTCC
CAGATGTTCTCCATCCATGCATTCTCTGCCATGGAGTCAGGGGTGCTAGTGGCCATGGCC
CTGGACCGCTCTGTGGCCATCTGCAACCCACTGCGTTATGCAACCATCCTTCCACCTGTT
GTTGTTGCCAAGATTGGAGGCCTGGTGGTGTTGTGAGGGGTGGGATTGACCATCTCCTTT
CCAAGCTTGGCCCATAGGCTGCACTACCATGGCTCACACATGATTGCCTATACCTTCTGT
GAGCATATGGCAGTGGTGAAGCTTGCCTGTGAGGCCACCACTGTGGACAACCTCTATGCC
TTTGTGGTGGCAATCTTTCTTGGTGGGGGGGATGTGGTCTTATTGCCTATTCTTATGGGC
TGATTGTGAGGACTGTAATGCATTTTCCTTCACCTGAGGAACGTGCGAAAGCAGGCAGCA
CATGTACAGCCCATGTCTGTGTCATCCTCTTCTTCTATGGACTGGGCTTTCTTTCTGTGG
TCATGCAGCGCTTTGGAGCACCCACAGCTTCTACTGCCAAGGTCATCCTTGCCAATCTCT
ACTTGCTCTTTCCCCCAGCACTGGATCCCATTGTCTATGGCATGGAGACCAAGCAGATCT
AGGAGCGGCTATTGATGATTCTAAGCCCCAAGCAGATTGAGCTTACC
Conceptual translation FFSNNSVLFPHTFFLAGIPGLTATHIWISLPFCFMFFLSLTGNGVLLFLIRTECSLRQPM
FLFLAMLSFVDLVLSLSTLPKMLAIFWFGATAISSHSCLSQMFSIHAFSAMESGVLVAMA
LDRSVAICNPLRYATILPPVVVAKIGGLVVLXVGLTISFPSLAHRLHYHGSHMIAYTFC
EHMAVVKLACEATTVDNLYAFVVAIFLGGGDVV/IAYSYGLIVRTVMHFPSPEERAKAG
STCTAHVCVILFFYGLGFLSVVMQRFGAPTASTAKVILANLYLLFPPALDPIVYGMETKQ
IXRLLMILSPKQIELT

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP T/C 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 6,066,882 6,066,882 SNP T/C 1000GP (CEU, CHBJPT)
11 6,067,168 6,067,168 SNP C/A 1000GP (CEU, CHBJPT)
11 6,067,203 6,067,203 SNP T/C 1000GP (CHBJPT)
11 6,067,482 6,067,482 SNP G/A 1000GP (CEU, CHBJPT)
11 6,067,508 6,067,508 SNP C/T 1000GP (CEU, CHBJPT)
11 6,067,594 6,067,594 SNP G/A 1000GP (CEU)
11 6,067,641 6,067,641 SNP C/T 1000GP (CHBJPT)
11 6,088,112 6,088,112 SNP C/T rs7948696 (DbSNP)
11 6,088,398 6,088,398 SNP A/C rs10839353 (DbSNP)
11 6,088,712 6,088,712 SNP A/G rs7930953 (DbSNP)
11 6,088,738 6,088,738 SNP C/T rs59722231 (DbSNP)
11 6,088,784 6,088,784 SNP A/G rs35702002 (DbSNP)
11 6,088,824 6,088,824 SNP A/G rs7931072 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 5,505,764 6,194,475 CopyNumber Variation_34458 (DGV)
11 6,076,999 6,117,545 CopyNumber Variation_71268 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.