Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52Y1P Olfactory Receptor

Gene Symbol OR52Y1P1 (View this gene in GeneCards)
Family 52
Subfamily Y
Pseudogene Yes
CORP pseudogene probability score
Aliases ORL3534
External Ids HGNC: 15240   GeneBank: NG_004215   ORDB: ORL3534   
Build #39 labels OR52Y1P, OR52Y2P
Chromosomal location 11:4,793,769-4,794,262 (-)
Cluster 11@5
Synteny CLIC#23
Remarks Disrupted by LTR repeat

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52R1 36.67% 150

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52R1 36% 155
Chimp CONTIG465.133-22970 94% 148
Mouse Or52r1b 37% 155
Rat Or52r1c 37% 156
Cow OR52R1 38% 156

Sequence information

Nucleotide sequence ATGACACAGAGTGTACTGTGAATGAGCCCTTTTGCTTCATGTTCTCCTAGATGCCCTTCT
GCCTCAGCTAGATCTTGCCCTAGACCTACTATGAGCAAGTGGTCATGCTGAATCTGGTAT
GTGCAGACATCACATATATAGTCCGTACCTGTGGTCTCTTATGGCCTTTTCTGTGGTTGG
ATTTGATATATTTGTCATTAGAACCACAGATATCAGACATTGCAGGCTGTACTGTAGCTA
CCTGCAGAGAATCTCTGCCCAAGGTATTTAGCATATATGCCTTCCACATTTGTGTCACCC
TGTTCCTGCACATCTCAGTATTCTACTCCTTTTTCTCTTGTTGCTTTTGCTACCATACAC
TCACAGTGATTCCCATCTCCTTGCTCATCCTTTACTCATTAGTGCCTTCCATGTTCAATA
CCATCACCTGTGGGGTAAAGAGTAAGCATATCCAAGAAAACATGGTACAGAGATTTTGTG
GGAAAATTTCCTGC
Conceptual translation MFSXPFCLSXLPXYYEQVVMLNLVCAD\HIXVPVVSYGLFCGWIXICHXHRYQ
TLQAVLXPA/ESLPKVFSIYAFHICVTLFLHISVFYSFFSCCFCYHTLTVIPISLLIL
YSLVPSMFNTITCGVKSKHIQENMVQRFCGKISC

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 4,815,466 4,815,466 Del(1) -/G rs35419998 (DbSNP)
11 4,815,463 4,815,464 mnp CT/TG rs67677655 (DbSNP)
11 4,815,206 4,815,206 SNP A/G rs10768241 (DbSNP)
11 4,815,464 4,815,464 SNP A/G rs10742386 (DbSNP)
11 4,815,190 4,815,190 SNP A/G rs17247598 (DbSNP)
11 4,815,348 4,815,348 SNP C/T rs10768242 (DbSNP)
11 4,815,463 4,815,464 mixed -/A/C rs10742385 (DbSNP)
11 4,793,960 4,793,960 SNP A/G 1000GP (CEU)
11 4,793,976 4,793,976 SNP G/A 1000GP (CEU, CHBJPT)
11 4,794,118 4,794,118 SNP C/T 1000GP (CEU, CHBJPT)
11 4,794,233 4,794,233 SNP A/C 1000GP (CEU, CHBJPT)
11 4,794,234 4,794,234 SNP G/A 1000GP (CEU, CHBJPT)
11 100 -100 SNP G/A 1000GP (YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 4,813,583 4,820,635 CopyNumber Variation_71254 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.