Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR55B1P Olfactory Receptor

Gene Symbol OR55B1P1 (View this gene in GeneCards)
Family 55
Subfamily B
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-2, HsOR11.3.1P, ORL3611
External Ids HGNC: 15241   GeneBank: BK004562, NG_004317   ORDB: ORL3611   
Build #39 labels OR55B1P, OR55B2P, OR55C1P
Chromosomal location 11:4,146,316-4,147,295 (-)
Cluster 11@4b
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52B1P 35.5% 307
OR52B2 36.3% 292
OR52L1 35.05% 311

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR55B1 84% 325
Chimp CONTIG1026.5-8142 98% 327
Mouse Or55b3 78% 326
Rat Or55b3 80% 303
Cow OR55B1 82% 327

Sequence information

Nucleotide sequence ATGGGTGAGGATGGAAATACAAGCACCTTCAACATCTCCTGCACCAAGTTCTTCCTGGTG
GGTTTCCCTGGACTTCGAGAGTGGTGGCCCCTTCTGGTCCTGCCTCTTGTCTTCCTCTTT
GTGACCATCATCTCTGCCAATGCCCTGGTCATCCACACAGTGGTTGCCCGGCAAAATCTG
CATCAGCCTACGTGTATGCTCATCACTGTGCTCCTGGCTGTCAATATTCGTGCTGCCACA
GCCGTGATGCCTAAAATGCTGGAGGGCTTTGTATATTATGCTAACCCCATATCGCTGCAT
GGCCGCCTGGCCTAGGTGTTCTTTATCTACTTCACCCTCCTCCTGGACTACAACTTCCTC
TGGCCATGGCCCTGGACTGCTACGTAGCCATCTGCCACCCACTCTGCTATTCTGACCTGA
TGACCTCCCAGCTGCTGGGACTGCTGGCCATTCTTGCCTTGACACAGAGCCTGGGAGTGA
CAGTGCCCTTGGTAGTACTAACTGCAAAAGCCCGATTCTGCCGGACAGCAGTGATTCGAC
ACTTCACCTGTGAGTGCATTGCACTGCTGAGCATAGCTTGTGGAGACCTGACCTTCAACA
ACTGGCTGGGGCTGGCTATGTGTTTGGTCACTGTAATCTCTGATATGGCCCTGCTGGGGA
CCTCCTACACCCACATCATCTATGCTGCCTTCCGGATCTCTTCTTGGGGAGCCCAAGCCA
AGGCCTTACACACGTGTGGCTCCCACCTACTGGTCATCCTCTCCATCTACGTCTCTGGTC
TTTCCACTTCCATCACCTTCTGAGTAGCCAAGACTGTGTCCCAGAATGTCCAGAATCTAC
TCAGTGCCATATACTTGCTGCTTCCAGGAGCCTTGAATCCTGTCATTTATGGGGTGAGGA
CTAGGGAGATCCAGCAACATGTAGAAAAGATGCTCTGTGAAAAGGAAACAGCCCAGAAGG
CTGGGGAGAAGCCAAAGAGG
Conceptual translation MGEDGNTSTFNISCTKFFLVGFPGLREWWPLLVLPLVFLFVTIISANALVIHTVVARQNL
HQPTCMLITVLLAVNIRAATAVMPKMLEGFVYYANPISLHGRLAXFFIYFTLLLDYNF/br/>LLAMALDCYVAICHPLCYSDLMTSQLLGLLAILALTQSLGVTVPLVVLTAKARFCRTAVI
RHFTCECIALLSIACGDLTFNNWLGLAMCLVTVISDMALLGTSYTHIIYAAFRISSWGAQ
AKALHTCGSHLLVILSIYVSGLSTSITFXAKTVSQNVQNLLSAIYLLLPGALNPVIYGV
RTREIQQHVEKMLCEKETAQKAGEKPKR

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP G/T 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 4,146,374 4,146,374 SNP A/G 1000GP (CEU, CHBJPT)
11 4,146,659 4,146,659 SNP A/G 1000GP (CEU, CHBJPT)
11 4,146,673 4,146,673 SNP A/C 1000GP (CEU, CHBJPT)
11 4,146,767 4,146,767 SNP G/A 1000GP (CEU, CHBJPT)
11 4,146,799 4,146,799 SNP T/C 1000GP (CEU, CHBJPT)
11 4,146,816 4,146,816 SNP T/C 1000GP (CEU, CHBJPT)
11 4,146,910 4,146,910 SNP T/C 1000GP (CEU, CHBJPT)
11 4,147,078 4,147,078 SNP G/T 1000GP (CEU, CHBJPT)
11 4,147,088 4,147,088 SNP C/T 1000GP (CEU, CHBJPT)
11 4,147,089 4,147,089 SNP A/G 1000GP (CEU, CHBJPT)
11 4,147,102 4,147,102 SNP C/T 1000GP (CEU, CHBJPT)
11 4,147,105 4,147,105 SNP G/A 1000GP (CEU, CHBJPT)
11 4,147,113 4,147,113 SNP A/G 1000GP (CEU, CHBJPT)
11 4,167,604 4,167,604 SNP A/G rs10742246 (DbSNP)
11 4,167,726 4,167,726 SNP A/G rs12290431 (DbSNP)
11 4,167,846 4,167,846 SNP A/G rs56167232 (DbSNP)
11 4,167,889 4,167,889 SNP A/G rs10767857 (DbSNP)
11 4,167,903 4,167,903 SNP A/C rs10742247 (DbSNP)
11 4,167,997 4,167,997 SNP A/G rs7126014 (DbSNP)
11 4,168,029 4,168,029 SNP C/T rs10767858 (DbSNP)
11 4,168,046 4,168,046 SNP C/T rs7115496 (DbSNP)
11 4,168,140 4,168,140 SNP C/T rs7115615 (DbSNP)
11 4,168,308 4,168,308 SNP G/T rs10835684 (DbSNP)
11 4,168,318 4,168,318 SNP C/T rs4399323 (DbSNP)
11 4,168,318 4,168,319 mnp CA/TG rs71472160 (DbSNP)
11 4,168,319 4,168,319 SNP A/G rs4593997 (DbSNP)
11 4,168,332 4,168,332 SNP C/T rs4399324 (DbSNP)
11 4,168,335 4,168,335 SNP A/G rs4480537 (DbSNP)
11 4,168,343 4,168,343 SNP A/G rs4593998 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 4,055,945 4,510,188 CopyNumber Variation_3834 (DGV)
11 4,162,474 4,325,792 CopyNumber Variation_8675 (DGV)
11 4,162,477 4,325,792 CopyNumber Variation_2898 (DGV)
11 4,165,546 4,168,625 CopyNumber #50 (Waszak)
11 4,166,641 4,378,126 CopyNumber Variation_30537 (DGV)
11 4,167,416 4,238,930 CopyNumber Variation_9649 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.