Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR56A1 Olfactory Receptor

Gene Symbol OR56A11 (View this gene in GeneCards)
Family 56
Subfamily A
Pseudogene No
CORP pseudogene probability score 0.6 (pseudogene)
Aliases OR11-75, HsOR11.3.94, ORL3283
External Ids HGNC: 14781   GeneBank: AB065821, BK004252, NM_001001917   ORDB: ORL3283   
Build #39 labels OR56A1
Chromosomal location 11:6,026,751-6,027,692 (-)
Cluster 11@6
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR56A4 83.33% 312
OR56A5 79.49% 312
OR56A7P 82.11% 313

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR56A1 93% 312
Chimp CONTIG465.8-2585 99% 314
Mouse Or56a4 78% 308
Rat Or56a5 76% 312
Cow OR56A1 85% 313
Cow OR56A4D 81% 312
Cow OR56A1CP 80% 313

Expression evidences

Source Accession
mRNA BC136911

Sequence information

Nucleotide sequence ATGGCGTCACCCAGCAACAGCTCCACTGTCCCAGTCTCTGAATTCCTCCTCATCTGCTTC
CCCAACTTCCAGAGTTGGCAGCACTGGCTCTCCCTGCCCCTCAGCCTTCTCTTCCTCCTG
GCCATGGGAGCTAACACCACCCTCCTGATCACCATCCAGCTGGAGGCCTCTCTGCACCAG
CCCCTGTACTACCTGCTCAGCCTCCTCTCCCTGCTGGACATCGTGCTCTGCCTCACCGTC
ATCCCCAAGGTCCTGGCCATCTTCTGGTATGATCTTAGGTCGATCAGCTTCCCTGCCTGC
TTCCTCCAGATGTTCATCATGAACAGTTTCCTCCCCATGGAGTCCTGCACGTTTATGGTC
ATGGCCTATGACCGTTATGTGGCCATCTGCCACCCACTGCGGTACCCATCCATCATCACT
AATCAATTTGTGGCCAAAGCTAGTGTCTTCATTGTGGTGCGGAATGCGCTTCTTACTGCA
CCCATTCCTATCCTCACTTCCCTGCTCCATTACTGTGGGGAAAATGTCATTGAGAACTGC
ATCTGTGCCAACTTGTCTGTGTCCAGGCTCTCCTGTGATAATTTCACCCTTAACAGAATC
TACCAATTTGTGGCTGGTTGGACCTTGCTGGGCTCAGATTTATTCCTCATCTTCCTCTCT
TACACCTTCATTCTAAGAGCTGTGCTTAGATTCAAAGCAGAGGGGGCGGCAGTGAAGGCC
CTGAGCACATGTGGCTCCCACTTCATCCTCATTCTTTTCTTCAGCACCATACTGCTGGTT
GTGGTGTTGACAAACGTGGCCAGAAAGAAGGTCCCCATGGACATCCTGATCCTGCTGAAC
GTCCTTCATCACCTTATTCCTCCTGCATTGAACCCTATTGTGTATGGGGTTCGGACCAAA
GAGATAAAACAGGGAATTCAGAAGTTACTGCAGAGAGGGAGG
Conceptual translation MASPSNSSTVPVSEFLLICFPNFQSWQHWLSLPLSLLFLLAMGANTTLLITIQLEASLHQ
PLYYLLSLLSLLDIVLCLTVIPKVLAIFWYDLRSISFPACFLQMFIMNSFLPMESCTFMV
MAYDRYVAICHPLRYPSIITNQFVAKASVFIVVRNALLTAPIPILTSLLHYCGENVIENC
ICANLSVSRLSCDNFTLNRIYQFVAGWTLLGSDLFLIFLSYTFILRAVLRFKAEGAAVKA
LSTCGSHFILILFFSTILLVVVLTNVARKKVPMDILILLNVLHHLIPPALNPIVYGVRTK
EIKQGIQKLLQRGR

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 6,048,400 6,048,399 Ins(1) -/T rs72527977 (DbSNP)
11 6,048,056 6,048,056 SYN C/T A/A rs11040335 (DbSNP)
11 6,026,826 6,026,826 SYN T/C A/A 1000GP (CEU)
11 100 -100 SYN T/C A/A 1000GP (YRI)

Variations - CNVs

Chr Start End Type Sources
11 5,505,764 6,194,475 CopyNumber Variation_34458 (DGV)
11 6,045,981 6,049,022 CopyNumber #65 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

G239A C176F % Freq CORP
1 G C 99.62 0.633
2 G F 0.31 0.633
3 A C 0.08 0.633

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR56A1.aApr07-unspliced main_exon 3UTR chr11 6,026,748 6,026,751 -
CDS chr11 6,026,751 6,027,692 -
5UTR chr11 6,027,692 6,027,704 -