Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR56A3 Olfactory Receptor

Gene Symbol OR56A31 (View this gene in GeneCards)
Family 56
Subfamily A
Pseudogene No
CORP pseudogene probability score 0.54 (pseudogene)
Aliases OR11-48, OR11-59, OR11-51, HsOR11.3.90
External Ids HGNC: 14786   GeneBank: BK004305, BK004554   
Build #39 labels OR56A6, OR56A3P
Chromosomal location 11:5,947,347-5,948,291 (+)
Cluster 11@6
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR56A1 78.32% 309
OR56A4 75.72% 313

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR56A3 83% 314
Dog OR56A3E 86% 314
Dog OR56A3FP 85% 313
Dog OR56A3C 84% 314
Dog OR56A3D 84% 314
Chimp CONTIG*********** 99% 315
Mouse Or56a3b 85% 314
Mouse Or56a3 85% 314
Rat Or56a3b 87% 314
Cow OR56A3 88% 314
Cow OR56A3IP 81% 313
Cow OR56A3H 81% 314

Expression evidences

Source Accession
GNF Atlas2 gnf1h10967_at

Sequence information

Nucleotide sequence ATGACAACACACCGAAATGACACCCTCTCCACTGAAGCTTCAGACTTCCTCTTGAATTGT
TTTGTCAGATCCCCCAGCTGGCAGCACTGGCTGTCCCTGCCCCTCAGCCTCCTTTTCCTC
TTGGCCGTAGGGGCCAACACCACCCTCCTGATGACCATCTGGCTGGAGGCCTCTCTGCAC
CAGCCCCTGTACTACCTGCTCAGCCTCCTCTCCCTGCTGGACATCGTGCTCTGCCTCACT
GTCATCCCCAAGGTCCTGACCATCTTCTGGTTTGACCTCAGGCCCATCAGCTTCCCTGCC
TGCTTCCTCCAGATGTACATCATGAATTGTTTCCTAGCCATGGAGTCTTGCACATTCATG
GTCATGGCCTATGATCGTTATGTAGCCATCTGCCACCCACTGAGATATCCATCAATCATC
ACTGATCACTTTGTAGTCAAGGCTGCCATGTTTATTTTGACCAGAAATGTGCTTATGACT
CTGCCCATCCCCATCCTTTCAGCACAACTCCGTTATTGTGGAAGAAATGTCATTGAGAAC
TGCATCTGTGCCAATATGTCTGTTTCCAGACTCTCCTGCGATGATGTCACCATCAATCAC
CTTTACCAATTTGCTGGAGGCTGGACTCTGCTAGGATCTGACCTCATCCTTATCTTCCTC
TCCTACACCTTCATTCTGCGAGCTGTGCTGAGACTCAAGGCAGAGGGTGCCGTGGCAAAG
GCCCTAAGCACATGTGGCTCCCACTTCATGCTCATCCTCTTCTTCAGCACCATCCTTCTG
GTTTTTGTCCTCACACATGTGGCTAAGAAGAAAGTCTCCCCTGATGTGCCAGTCTTGCTC
AATGTTCTCCACCATGTCATTCCTGCAGCCCTTAACCCCATCATTTACGGGGTGAGAACC
CAAGAAATTAAGCAGGGAATGCAGAGGTTGTTGAAGAAAGGGTGC
Conceptual translation MTTHRNDTLSTEASDFLLNCFVRSPSWQHWLSLPLSLLFLLAVGANTTLLMTIWLEASLH
QPLYYLLSLLSLLDIVLCLTVIPKVLTIFWFDLRPISFPACFLQMYIMNCFLAMESCTFM
VMAYDRYVAICHPLRYPSIITDHFVVKAAMFILTRNVLMTLPIPILSAQLRYCGRNVIEN
CICANMSVSRLSCDDVTINHLYQFAGGWTLLGSDLILIFLSYTFILRAVLRLKAEGAVAK
ALSTCGSHFMLILFFSTILLVFVLTHVAKKKVSPDVPVLLNVLHHVIPAALNPIIYGVRT
QEIKQGMQRLLKKGC

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 5,968,653 5,968,653 Del(1) -/G rs34047152 (DbSNP)
11 5,968,728 5,968,728 NS T/C M/T rs1840178 (DbSNP)
11 5,969,185 5,969,185 SYN A/G Q/Q rs10769378 (DbSNP)
11 5,947,955 5,947,955 SYN A/G Q/Q 1000GP (CEU, CHBJPT)
11 5,947,498 5,947,498 NS T/C M/T 1000GP (CEU, CHBJPT)
11 100 -100 NS T/C M/T 1000GP (YRI)
11 100 -100 SYN A/G Q/Q 1000GP (YRI)

Variations - CNVs

Chr Start End Type Sources
11 5,868,055 6,007,613 CopyNumber Variation_2903 (DGV)
11 5,730,377 5,970,717 CopyNumber Variation_3836 (DGV)
11 5,885,711 5,969,185 CopyNumber Variation_8676 (DGV)
11 5,505,764 6,194,475 CopyNumber Variation_34458 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

M51T % Freq CORP
1 T 54.45 0.558
2 M 45.55 0.558

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR56A3.aApr07-unspliced main_exon CDS chr11 5,947,347 5,948,291 +
3UTR chr11 5,948,291 5,948,294 +