Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR56A5 Olfactory Receptor

Gene Symbol OR56A51 (View this gene in GeneCards)
Family 56
Subfamily A
Pseudogene No
CORP pseudogene probability score 0.49 (functional)
Aliases HsOR11.3.91
External Ids HGNC: 14792   GeneBank: NG_002219, XM_372371   
Build #39 labels OR56A5P
Chromosomal location 11:5,967,556-5,968,494 (-)
Cluster 11@6
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR56A4 87.22% 313

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR56A4C 89% 313
Chimp CONTIG465.12-22001 100% 313
Mouse Or56a4 83% 309
Mouse Or56a5 85% 312
Rat Or56a5 85% 312
Cow OR56A4P 86% 309
Cow OR56A4D 87% 313
Cow OR56A4E 84% 313

Expression evidences

Source Accession
GNF Atlas2 gnf1h05431_at
GNF Atlas2 gnf1h05432_x_at
GNF Atlas2 gnf1h11014_at

Sequence information

Nucleotide sequence ATGACATTACCCAGCAACAACTCCACTTCCCCAGTCTTTGAATTCTTCCTCATTTGTTTC
CCCAGTTTCCAGAGCTGGCAGCACTGGCTGTCTCTGCCCCTCAGCCTCCTCTTCCTCCTG
GCCATGGGGGCCAATGCCACCCTTCTGATCACCATCTATCTGGAAGCCTCTCTGCACCAG
CCCCTGTACTACCTGCTCAGCCTCCTCTCCCTGCTGGACATCGTACTCTGCCTCACCGTC
ATCCCCAAGGTCCTGGCCATCTTCTGGTTTGACCTCAGATCAATCAGCTTCCCTGCCTGC
TTCCTTCAGGTGTTCATCATGAACAGTTTTCTGACTATGGAGTCCTGCACATTCATGATC
ATGGCCTATGACCGCTATGTGGCCATCTGCAAGCCCCTACAGTACTCATCCATCATCACT
GATCAATTTGTCGCTAGGGCTGCCATCTTTGTTGTGGCCAGGAATGGCCTTCTTACTATG
CCTATCCCCATACTTTCTTCTCGACTCAGATACTGTGCAGGACACATCATCAAGAACTGC
ATCTGTACTAACGTGTCTGTGTCTAAACTCTCTTGTGATGACATCACCTTGAATCAGAGC
TACCAGTTTGTTATAGGTTGGACCCTGCTGGGCTCTGACCTCATCCTTATTGTTCTCTCT
TACTTTTTTATCTTGAAAACTGTGCTAAGGATTAAGGGTGAGGGAGATATGGCCAAAGCT
CTAGGTACTTGTGGTTCCCACTTCATCCTCATCCTCTTCTTCACCACAGTCCTGCTGGTT
CTGGTCATCACTAACCTGGCCAGGAAGAGAATTCCTCCGGATGTCCCCATCCTGCTCAAC
ATCCTGCACCACCTTATTCCCCCAGCTCTGAACCCCATTGTTTATGGTGTGAGAACCAAG
GAGATCAAGCAGGGAATCCAGAACCTGCTGAGGAGGTTG
Conceptual translation MTLPSNNSTSPVFEFFLICFPSFQSWQHWLSLPLSLLFLLAMGANATLLITIYLEASLHQ
PLYYLLSLLSLLDIVLCLTVIPKVLAIFWFDLRSISFPACFLQVFIMNSFLTMESCTFMI
MAYDRYVAICKPLQYSSIITDQFVARAAIFVVARNGLLTMPIPILSSRLRYCAGHIIKNC
ICTNVSVSKLSCDDITLNQSYQFVIGWTLLGSDLILIVLSYFFILKTVLRIKGEGDMAKA
LGTCGSHFILILFFTTVLLVLVITNLARKRIPPDVPILLNILHHLIPPALNPIVYGVRTK
EIKQGIQNLLRRL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 5,989,223 5,989,223 nonsense SNP A/G */R rs61730422 (DbSNP)
11 5,989,415 5,989,415 NS A/C/T L/V rs7114672 (DbSNP)
11 5,988,907 5,988,907 NS A/G L/P rs7113015 (DbSNP)
11 5,989,191 5,989,191 NS C/G K/N rs61737576 (DbSNP)
11 5,989,293 5,989,293 SYN A/G V/V rs7113548 (DbSNP)
11 5,989,686 5,989,686 SYN A/G F/F rs74053258 (DbSNP)
11 5,967,993 5,967,993 nonsense SNP G/A R/* 1000GP (CEU)
11 5,968,185 5,968,185 NS C/T V/M 1000GP (CEU, CHBJPT)
11 5,968,052 5,968,052 NS G/A A/V 1000GP (CEU)
11 5,968,063 5,968,063 SYN G/A V/V 1000GP (CEU, CHBJPT)
11 100 -100 SYN C/T P/P 1000GP (YRI, YRI)
11 100 -100 NS G/A P/L 1000GP (YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 5,868,055 6,007,613 CopyNumber Variation_2903 (DGV)
11 5,505,764 6,194,475 CopyNumber Variation_34458 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

P205L L191P N116I K110N R100* A80V % Freq CORP
1 P L N K R A 93.55 0.989
2 P L N K * A 3.46 1.200
3 P L N K R V 1.46 0.989
4 P L N N R A 0.69 0.989
5 L L N K R A 0.31 0.989
6 P P N K R A 0.31 0.989
7 P L I K R A 0.23 0.989