Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR56A7P Olfactory Receptor

Gene Symbol OR56A7P1 (View this gene in GeneCards)
Family 56
Subfamily A
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR11.3.95P, ORL3626
External Ids HGNC: 15244   GeneBank: NG_004214   ORDB: ORL3626   
Build #39 labels OR56A7P
Chromosomal location 11:6,045,810-6,046,747 (-)
Cluster 11@6
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR56A1 82.11% 313

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR56A1 81% 314
Dog OR56A1B 82% 314
Chimp CONTIG465.6-494 98% 313
Mouse Or56a4 70% 308
Rat Or56a5 67% 312
Cow OR56A1 78% 313

Sequence information

Nucleotide sequence ATGACATTACCCAGCGATGACTCCACTGTCCCAGTCTCTGAATTCCTCCTCATCTGCTTC
CCCAACTTTCAGAGTTGGCAGCACTTGCTGTCCCTGCCCCTCAGCCTCCTTTCCTCCTGG
CCATGGGGACCAACACCCACCCCCCCCATCACCATCCACCTGGAGGCCTCTCTGCACCTG
CCCCTGTACTACCTGCCCAGCCTCCTCTCCCTGCTGGACATCGTGCTCTGCCTCACCGTC
ATCCCCAAGGTCCTGGCCATCTTCTGGTTTGATCTTAGGTCGATCGGCTTCCCTGCCTGC
TTCCTTCAGATGTTCATCATGAACAGTTTCCTCCCCATGGAGTCCTGCACATTCATGGTC
AAGGACTATGATCATTATGTGGCCATCTGCCACCCACTGCAGTACCTGTCCATCATCACT
CATCAATTTGTGGCCAAAGCTAGTGTCTTCATTGTGGTGCAGAATGCTTTGCTGCTTTCA
CCTGTTCCTATTCTCTCTGCCCAGCTCCATTACTGTAGGAAAAATGTGATTGAGAACTGC
ATCTGTGCCAACCTGTCTGTGTCCAGGCTCTCCTGTGATAATTTCACCCTTAACAGACTC
TACCAATTTGTGGCTGGTTGGACCTTCCTGGGCTCGGATTTCATCCTCATCTTCCTCTCC
TACACCTTCATTCTAAGAGCTGTGCTTAGATTCAAGGTGGAGGGGGTGGCAGTGAAGGCC
CTGAGCACATGTGGCTCCCACTTTATCCTCATCCTCTTCTTCAGCACCTGCTGGTTGTGG
TGTTGACAAATGTGGCCAGAAAGAAGGTCCCCATGGACATCCTGATCCTGTTTAATGTCC
TTCATCCCTTTAGTCCTCCTGCATTAAACCCTATCATATGTGGATTTCAAACTAAAGAGT
TAAAGAAGGAATTTTAGAAGTTGCTGCAGAGGGGCCTT
Conceptual translation MTLPSDDSTVPVSEFLLICFPNFQSWQHLLSLPLSLLSSWPWGPTPTPPITIHLEASLHL
PLYYLPSLLSLLDIVLCLTVIPKVLAIFWFDLRSIGFPACFLQMFIMNSFLPMESCTFMV
KDYDHYVAICHPLQYLSIITHQFVAKASVFIVVQNALLLSPVPILSAQLHYCRKNVIENC
ICANLSVSRLSCDNFTLNRLYQFVAGWTFLGSDFILIFLSYTFILRAVLRFKVEGVAVKA
LSTCGSHFILILFFST/LVVVLTNVARKKVPMDILILFNVLHPFSPPALNPIICGFQTK
ELKKEFXLLQRGL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 6,067,902 6,067,901 Ins(1) -/C rs11450639 (DbSNP)
11 6,067,962 6,067,962 SNP A/C rs12794035 (DbSNP)
11 6,067,208 6,067,208 SNP A/C rs7946120 (DbSNP)
11 6,067,928 6,067,928 SNP A/T rs7936017 (DbSNP)
11 6,067,568 6,067,568 SNP C/G rs74053074 (DbSNP)
11 6,067,516 6,067,516 SNP C/T rs7125154 (DbSNP)
11 6,067,527 6,067,527 SNP C/T rs73406066 (DbSNP)
11 6,067,869 6,067,869 SNP G/T rs35950270 (DbSNP)
11 6,067,921 6,067,921 SNP G/T rs12792426 (DbSNP)
11 6,045,978 6,045,978 SNP C/A 1000GP (CEU, CHBJPT)
11 100 -100 SNP C/A 1000GP (YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 5,505,764 6,194,475 CopyNumber Variation_34458 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.