Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR56B1 Olfactory Receptor

Gene Symbol OR56B11 (View this gene in GeneCards)
Family 56
Subfamily B
Pseudogene No
CORP pseudogene probability score 0 (functional)
Aliases OR11-65, HsOR11.3.77
External Ids HGNC: 15245   GeneBank: AB065812, BK004386, NM_001005180   
Build #39 labels OR56B1P
Chromosomal location 11:5,736,526-5,737,488 (+)
Cluster 11@6
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR56B2P 73.29% 292

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR56B1 83% 321
Chimp CONTIG*********** 98% 321
Mouse Or56b1 86% 311
Mouse Or56b1b 81% 312
Rat Or56b1 83% 312
Cow OR56B2C 74% 304

Expression evidences

Source Accession
ESTs DB108991
mRNA BC137185

Sequence information

Nucleotide sequence ATGTCTGCATCTCTCAAAATCTCCAATAGCTCCAAATTCCAGGTCTCTGAGTTCATCCTG
CTGGGATTCCCGGGCATTCACAGCTGGCAACACTGGCTATCTCTGCCCCTGGCACTACTG
TATCTCTCAGCACTTGCTGCAAACACCCTCATCCTCATCATCATCTGGCAGAACCCTTCT
TTACAGCAGCCCATGTATATTTTCCTTGGCATCCTCTGTATGGTAGACATGGGTCTGGCC
ACTACTATCATCCCTAAGATCCTGGCCATCTTCTGGTTTGATGCCAAGGTTATTAGCCTC
CCTGAGTGCTTTGCTCAGATTTATGCCATTCACTTCTTTGTGGGCATGGAGTCTGGTATC
CTACTCTGCATGGCTTTTGATAGATATGTGGCTATTTGTCACCCTCTTCGCTATCCATCA
ATTGTCACCAGTTCCTTAATCTTAAAAGCTACCCTGTTCATGGTGCTGAGAAATGGCTTA
TTTGTCACTCCAGTGCCTGTGCTTGCAGCACAGCGTGATTATTGCTCCAAGAATGAAATT
GAACACTGCCTGTGCTCTAACCTTGGGGTCACAAGCCTGGCTTGTGATGACAGGAGGCCA
AACAGCATTTGCCAGTTGGTTCTGGCATGGCTTGGAATGGGGAGTGATCTAAGTCTTATT
ATACTGTCATATATTTTGATTCTGTACTCTGTACTTAGACTGAACTCAGCTGAAGCTGCA
GCCAAGGCCCTGAGCACTTGTAGTTCACATCTCACCCTCATCCTTTTCTTTTACACTATT
GTTGTAGTGATTTCAGTGACTCATCTGACAGAGATGAAGGCTACTTTGATTCCAGTTCTA
CTTAATGTGTTGCACAACATCATCCCCCCTTCCCTCAACCCTACAGTTTATGCACTTCAG
ACCAAAGAACTTAGGGCAGCCTTCCAAAAGGTGCTGTTTGCCCTTACAAAAGAAATAAGA
TCT
Conceptual translation MSASLKISNSSKFQVSEFILLGFPGIHSWQHWLSLPLALLYLSALAANTLILIIIWQNPS
LQQPMYIFLGILCMVDMGLATTIIPKILAIFWFDAKVISLPECFAQIYAIHFFVGMESGI
LLCMAFDRYVAICHPLRYPSIVTSSLILKATLFMVLRNGLFVTPVPVLAAQRDYCSKNEI
EHCLCSNLGVTSLACDDRRPNSICQLVLAWLGMGSDLSLIILSYILILYSVLRLNSAEAA
AKALSTCSSHLTLILFFYTIVVVISVTHLTEMKATLIPVLLNVLHNIIPPSLNPTVYALQ
TKELRAAFQKVLFALTKEIRS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 5,758,398 5,758,397 Ins(1) -/G rs36073866 (DbSNP)
11 5,758,002 5,758,002 NS A/G I/V rs74051091 (DbSNP)
11 5,758,270 5,758,270 NS A/G H/R rs62617826 (DbSNP)
11 5,758,062 5,758,062 NS C/T R/C rs7397032 (DbSNP)
11 5,758,386 5,758,386 NS C/T L/F rs62621167 (DbSNP)
11 5,758,447 5,758,447 NS G/T G/V rs35783800 (DbSNP)
11 5,758,118 5,758,118 SYN A/C L/L rs7396766 (DbSNP)
11 5,758,646 5,758,646 SYN C/T Y/Y rs4486660 (DbSNP)
11 5,757,785 5,757,785 SYN C/T S/S rs12792180 (DbSNP)
11 5,736,888 5,736,888 SYN A/C L/L 1000GP (CEU, CHBJPT)
11 5,736,832 5,736,832 NS T/C C/R 1000GP (CEU, CHBJPT)
11 5,736,555 5,736,555 SYN C/T S/S 1000GP (CEU, CHBJPT)
11 5,737,416 5,737,416 SYN T/C Y/Y 1000GP (CEU, CHBJPT)
11 5,736,821 5,736,821 NS G/A S/N 1000GP (CHBJPT)
11 5,736,923 5,736,923 NS G/T C/F 1000GP (CHBJPT)
11 100 -100 SYN C/T S/S 1000GP (YRI, YRI)
11 100 -100 NS A/G I/V 1000GP (YRI, YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 5,730,377 5,970,717 CopyNumber Variation_3836 (DGV)
11 5,505,764 6,194,475 CopyNumber Variation_34458 (DGV)
11 5,757,656 5,760,718 Deletion #200 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

I86V K89R S102N C106R N161H R175H L214F S221N % Freq CORP
1 I K S R N R L S 71.66 0.026
2 I K S C N R L S 20.12 0.026
3 I K S C N H L S 3.76 0.026
4 I K S R N R F S 2.15 0.026
5 I K N C N R L S 0.92 0.026
6 V K S R N R L S 0.61 0.026
7 I K S C N R L N 0.38 0.026
8 I K S R H R L S 0.23 0.026
9 I R S C N R L S 0.08 0.026
10 I R S R N R L S 0.08 0.026