Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR56B3P Olfactory Receptor

Gene Symbol OR56B3P1 (View this gene in GeneCards)
Family 56
Subfamily B
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-68, HsOR11.3.99P, ORL3555
External Ids HGNC: 15247   GeneBank: AB065512, BK004707, NG_004390   ORDB: ORL3555   
Build #39 labels OR56B3P
Chromosomal location 11:6,128,610-6,129,553 (+)
Cluster 11@6
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR56B4 75.31% 320

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR56B6 79% 321
Mouse Or56b34 74% 321
Rat Or56b6b 71% 321
Cow OR56B42 67% 325
Orang OR56B4 75% 320
Horse OR56B46 78% 321
Chimp OR56B4 74% 320

Expression evidences

Source Accession
GNF Atlas2 gnf1h11138_at

Sequence information

Nucleotide sequence ATGGATATTGGCCTGAGTATAGCCAATAGCTCAGGGTTTCAACTGTCTGAGTTCATTCTG
ATAGGGTTCCCAGGCATTCATGAGTGGCAGCACTGGCTCTCCCTGCCCTTAGCTCTTGGT
GCCAATCTCCTCATCATAATCACCATTCAACATGAGACCATGCTACATGAACCCATGTAC
CATTTGCTGGGCATATTAGCAGTGGTGGACATTGGCCTGGCCACCACCATCATGCCCAAG
ATCCTGGCCATCTTCTGGTTTGATGCCAAGGCCATCAGCCTCCCTGAGTGTTTTGCTCAG
ATCTATGCCATCCACTCTTTCATGTGCATGGAGTCAGGCATCTTCCTCTGCATGGCAGTG
GATAGATATATGGCCATTTGTTATCCCCTTCAGTACACTTCCATAGTTACTGAAGCTTTT
GTCATCAAAGCCACACTGTCAGTAGTGCTCAGGAATGGCCTGTTGACCATCCCAGTGCCA
GTATTGGCTGCCCAGCGACACTACTGCTCCAGGAATGAGATTGATCAGTGCCTCTGCTCT
AACTTGGGGGTCACAAGTCTGGCCTGTGATGACACCACTATTAACAGGTTTTACCAGCTG
GCCTTGGTCTGGGTTGTGGTTGGGAGTGACATGGGTCTGGTCTTTGCTTCCTATTCTTTG
ATTATTCACTCAGTGCTGAAGCTGAACTCTGCTAAAGCAACATCTAAGGCCCTGAATACC
TGCAGCTCCCACCTTATCCTCATTCTCTTTTTCTACACAGCTATTATTGTAGTATCTGTC
ACCACCTGGCAGGAAGAAGGGCTCCCCGCATCCCTGTTCTCCTCAATGTGCTGCATATTG
TCATCCCCTCAGCCCTTAACCCCATAGTATATGCCCTTAGGACCTAGGAGCTGAGAGCAG
GCTTCCAGAAGCTGCTTGGTTTGGGCGAGTATGTGTCCAGGAAG
Conceptual translation MDIGLSIANSSGFQLSEFILIGFPGIHEWQHWLSLPLALGANLLIIITIQHETMLHEPMY
HLLGILAVVDIGLATTIMPKILAIFWFDAKAISLPECFAQIYAIHSFMCMESGIFLCMAV
DRYMAICYPLQYTSIVTEAFVIKATLSVVLRNGLLTIPVPVLAAQRHYCSRNEIDQCLCS
NLGVTSLACDDTTINRFYQLALVWVVVGSDMGLVFASYSLIIHSVLKLNSAKATSKALNT
CSSHLILILFFYTAIIVVSVTTWQEEGLPAS/VLLNVLHIVIPSALNPIVYALRTXLR
AGFQKLLGLGEYVSRK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP A/G 1000GP (YRI, YRI, YRI, YRI, YRI)
11 6,129,338 6,129,338 SNP C/T 1000GP (CEU, CHBJPT)
11 6,129,508 6,129,508 SNP A/G 1000GP (CEU, CHBJPT)
11 6,150,139 6,150,139 SNP A/G rs74055147 (DbSNP)
11 6,150,405 6,150,405 SNP A/G rs61743156 (DbSNP)
11 6,150,568 6,150,568 SNP T/C rs325638 (DbSNP)
11 6,150,628 6,150,628 SNP A/G rs74055148 (DbSNP)
11 6,150,738 6,150,738 SNP G/A rs325637 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 5,505,764 6,194,475 CopyNumber Variation_34458 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.