Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR56B4 Olfactory Receptor

Gene Symbol OR56B41 (View this gene in GeneCards)
Family 56
Subfamily B
Pseudogene No
CORP pseudogene probability score 0.03 (functional)
Aliases OR11-67, HsOR11.3.98, ORL3420
External Ids HGNC: 15248   GeneBank: AB065513, BK004325, NM_001005181   ORDB: ORL3420   
Build #39 labels OR56B4
Chromosomal location 11:6,107,779-6,108,735 (+)
Cluster 11@6
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR56B3P 75.31% 320

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR56B6 73% 320
Chimp CONTIG784.110-9201 98% 299
Mouse Or56b6 74% 275
Rat Or56b6b 69% 320
Cow OR56B2C 69% 305

Expression evidences

Source Accession
mRNA BC136880

Sequence information

Nucleotide sequence ATGGATACCTCCACCAGTGTTACCTATGACTCCAGCCTCCAGATTTCCCAGTTCATCCTG
ATGGGATTACCAGGCATTCATGAGTGGCAGCACTGGCTCTCCCTGCCCCTGACTCTGCTC
TACCTCTTAGCTCTTGGTGCCAATCTCCTCATCATAATCACCATTCAACATGAGACCGTG
CTACATGAACCCATGTACCATTTGCTGGGCATATTAGCAGTGGTGGACATTGGCCTGGCC
ACCACCATCATGCCCAAGATCCTGGCCATCTTCTGGTTTGATGCCAAGGCCATTAGCCTC
CCCATGTGTTTTGCTCAGATCTATGCCATCCACTGCTTCTTCTGCATAGAGTCAGGCATC
TTTCTCTGCATGGCAGTAGACAGATACATAGCCATCTGTCGCCCTCTTCAGTACCCCTCC
ATAGTCACTAAAGCTTTTGTCTTCAAAGCCACAGGGTTCATCATGCTCAGGAATGGCCTG
TTGACCATCCCAGTGCCTATACTGGCTGCCCAGAGACACTACTGTTCCAGGAATGAAATC
GAGCACTGCCTCTGCTCTAACTTGGGGGTTATCAGCCTGGCTTGTGATGACATCACTGTG
AACAAATTTTACCAACTGATGCTAGCATGGGTCTTGGTTGGGAGTGATATGGCTCTGGTA
TTTTCTTCCTATGCTGTAATCCTTCACTCTGTGCTGAGGCTGAACTCAGCAGAAGCAATG
TCCAAGGCTCTGAGCACTTGTAGCTCCCACCTCATCCTCATCCTCTTCCACACAGGTATC
ATTGTGCTGTCTGTCACACACCTTGCAGAGAAAAAGATTCCCCTTATTCCTGTGTTCCTT
AATGTGCTGCACAATGTCATCCCCCCTGCACTCAACCCCCTGGCCTGTGCACTCAGGATG
CACAAACTCAGACTGGGCTTTCAGAGACTGCTTGGACTGGGTCAGGACGTGTCCAAG
Conceptual translation MDTSTSVTYDSSLQISQFILMGLPGIHEWQHWLSLPLTLLYLLALGANLLIIITIQHETV
LHEPMYHLLGILAVVDIGLATTIMPKILAIFWFDAKAISLPMCFAQIYAIHCFFCIESGI
FLCMAVDRYIAICRPLQYPSIVTKAFVFKATGFIMLRNGLLTIPVPILAAQRHYCSRNEI
EHCLCSNLGVISLACDDITVNKFYQLMLAWVLVGSDMALVFSSYAVILHSVLRLNSAEAM
SKALSTCSSHLILILFHTGIIVLSVTHLAEKKIPLIPVFLNVLHNVIPPALNPLACALRM
HKLRLGFQRLLGLGQDVSK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS C/T P/S 1000GP (YRI)
11 100 -100 SYN G/A L/L 1000GP (YRI)
11 6,107,922 6,107,922 SYN T/C N/N 1000GP (CEU)
11 6,108,526 6,108,526 NS C/T H/Y 1000GP (CHBJPT)
11 6,108,607 6,108,607 NS C/T P/S 1000GP (CEU, CHBJPT)
11 6,129,152 6,129,152 SYN C/T N/N rs4758387 (DbSNP)
11 6,129,334 6,129,334 NS C/T A/V rs61745227 (DbSNP)
11 6,129,409 6,129,409 NS A/G H/R rs61743916 (DbSNP)
11 6,129,756 6,129,756 NS C/T H/Y rs58431577 (DbSNP)
11 6,129,837 6,129,837 NS C/T P/S rs1462983 (DbSNP)
11 6,129,923 6,129,923 SYN A/G L/L rs74055136 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 5,505,764 6,194,475 CopyNumber Variation_34458 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

H57Y H250Y P277S % Freq CORP
1 H H P 53.84 0.046
2 H H S 45.78 0.046
3 H Y S 0.31 0.397
4 Y H P 0.08 0.046

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR56B4.aApr07-unspliced main_exon CDS chr11 6,107,779 6,108,735 +
3UTR chr11 6,108,735 6,108,738 +