Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5A1 Olfactory Receptor

Gene Symbol OR5A11 (View this gene in GeneCards)
Family 5
Subfamily A
Pseudogene No
CORP pseudogene probability score 0.1 (functional)
Aliases OST181, OR11-249, HsOR11.13.6, ORL3301
External Ids HGNC: 8319   GeneBank: AB065804, AF399528, BK004310, NM_001004728   ORDB: ORL3301   
Build #39 labels OR5A1
Chromosomal location 11:59,443,169-59,444,113 (+)
Cluster 11@59a
Synteny CLIC#27
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5A2 67.33% 303

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5A1 87% 314
Chimp CONTIG229.375-29674 99% 315
Mouse Or5a1 84% 314
Rat Or5a1 82% 315
Cow OR5A1 83% 315

Expression evidences

Source Accession
mRNA BC137061
GNF Atlas2 gnf1h02106_at

Sequence information

Nucleotide sequence ATGTCCATAACCAAAGCCTGGAACAGCTCATCAGTGACCATGTTCATCCTCCTGGGATTC
ACAGACCATCCAGAACTCCAGGCCCTCCTCTTTGTGACCTTCCTGGGCATCTATCTTACC
ACCCTGGCCTGGAACCTGGCCCTCATTTTTCTGATCAGAGGTGACACCCATCTGCACACA
CCCATGTACTTCTTCCTAAGCAACTTATCTTTCATTGACATCTGCTACTCTTCTGCTGTG
GCTCCCAATATGCTCACTGACTTCTTCTGGGAGCAGAAGACCATATCATTTGTGGGCTGT
GCTGCTCAGTTTTTTTTCTTTGTCGGCATGGGTCTGTCTGAGTGCCTCCTCCTGACTGCT
ATGGCATACGACCGATATGCAGCCATCTCCAGCCCCCTTCTCTACCCCACTATCATGACC
CAGGGCCTCTGTACACGCATGGTGGTTGGGGCATATGTTGGTGGCTTCCTGAGCTCCCTG
ATCCAGGCCAGCTCCATATTTAGGCTTCACTTTTGCGGACCCAACATCATCAACCACTTC
TTCTGCGACCTCCCACCAGTCCTGGCTCTGTCTTGCTCTGACACCTTCCTCAGTCAAGTG
GTGAATTTCCTCGTGGTGGTCACTGTCGGAGGAACATCGTTCCTCCAACTCCTTATCTCC
TATGGTTACATAGTGTCTGCGGTCCTGAAGATCCCTTCAGCAGAGGGCCGATGGAAAGCC
TGCAACACGTGTGCCTCGCATCTGATGGTGGTGACTCTGCTGTTTGGGACAGCCCTTTTC
GTGTACTTGCGACCCAGCTCCAGCTACTTGCTAGGCAGGGACAAGGTGGTGTCTGTTTTC
TATTCATTGGTGATCCCCATGCTGAACCCTCTCATTTACAGTTTGAGGAACAAAGAGATC
AAGGATGCCCTGTGGAAGGTGTTGGAAAGGAAGAAAGTGTTTTCT
Conceptual translation MSITKAWNSSSVTMFILLGFTDHPELQALLFVTFLGIYLTTLAWNLALIFLIRGDTHLHT
PMYFFLSNLSFIDICYSSAVAPNMLTDFFWEQKTISFVGCAAQFFFFVGMGLSECLLLTA
MAYDRYAAISSPLLYPTIMTQGLCTRMVVGAYVGGFLSSLIQASSIFRLHFCGPNIINHF
FCDLPPVLALSCSDTFLSQVVNFLVVVTVGGTSFLQLLISYGYIVSAVLKIPSAEGRWKA
CNTCASHLMVVTLLFGTALFVYLRPSSSYLLGRDKVVSVFYSLVIPMLNPLIYSLRNKEI
KDALWKVLERKKVFS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 59,211,188 59,211,188 NS A/G N/D rs6591536 (DbSNP)
11 59,210,795 59,210,795 NS A/G I/V rs17153732 (DbSNP)
11 59,210,761 59,210,761 SYN C/G T/T rs11605572 (DbSNP)
11 59,211,325 59,211,325 SYN C/T V/V rs72923336 (DbSNP)
11 59,211,421 59,211,421 SYN C/T F/F rs17591107 (DbSNP)
11 59,211,265 59,211,265 SYN C/T T/T rs7941591 (DbSNP)
11 59,443,948 59,443,948 SYN C/T F/F 1000GP (CEU, CHBJPT)
11 59,443,715 59,443,715 NS G/A D/N 1000GP (CEU, CHBJPT)
11 59,444,085 59,444,085 NS A/C K/T 1000GP (CEU)
11 59,443,288 59,443,288 SYN C/G T/T 1000GP (CEU, CHBJPT)
11 59,443,792 59,443,792 SYN T/C T/T 1000GP (CEU, CHBJPT)
11 59,443,852 59,443,852 SYN C/T V/V 1000GP (CEU)
11 59,443,322 59,443,322 NS A/G I/V 1000GP (CHBJPT)
11 100 -100 SYN C/T L/L 1000GP (YRI, YRI, YRI)
11 100 -100 NS G/A D/N 1000GP (YRI)

Variations - CNVs

Chr Start End Type Sources
11 59,210,542 59,213,586 CopyNumber #78 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

I52V R146H D183N % Freq CORP
1 I R N 61.52 0.251
2 I R D 35.56 0.251
3 V R D 2.76 0.251
4 I H N 0.15 0.251

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5A1.aApr07-unspliced main_exon CDS chr11 59,443,169 59,444,113 +
3UTR chr11 59,444,113 59,444,116 +