Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5AC2 Olfactory Receptor

Gene Symbol OR5AC21 (View this gene in GeneCards)
Family 5
Subfamily AC
Pseudogene No
CORP pseudogene probability score 0.07 (functional)
Aliases HSA1, HsOR3.3.2, ORL3810
External Ids HGNC: 15431   GeneBank: AF179759, NM_054106   ORDB: ORL3810   
Build #39 labels OR5AC2
Chromosomal location 3:98,087,173-98,088,099 (+)
Cluster 3@98
Synteny CLIC#9
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5AC1P 72.96% 307

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5AC26 77% 304
Chimp CONTIG405.158-2376 98% 309
Mouse Or5ac16 71% 302
Rat Or5ac16 70% 302
Cow OR5AC26 72% 309

Expression evidences

Source Accession
mRNA AB528856

Sequence information

Nucleotide sequence ATGGATATATCAGAGGGAAATAAGACTCTTGTGACAGAGTTTGTTCTCACAGGACTTACA
GATCGACCATGGCTGCACGTCCTCTTCTTTGTTGTGTTTTTGGTGGTCTATCTCATCACC
ATGGTGGGCAACCTTGGACTGATAGTTCTAATTTGGAACGACCCCCATCTTCATATGCCC
ATGTACTTATTCCTTGGTGGTTTAGCCTTTTCAGATGCTTGTACTTCAACCTCTATAACC
CCTAGGATGCTGGTCAATTTCTTAGACAAGACTGCAATGATATCCCTAGCTGAGTGCATC
ACCCAGTTTTACTTTTTTGCTTCCAGTGCAACTACAGAATGCTTCCTCCTGGTGATGATG
GCCTATGACCGCTATGTAGCCATATGTAATCCCTTGCTTTATCCAGTGATGATGTCCAAC
AAACTCAGCGCTCAGTTGCTAAGTATTTCATATGTAATTGGTTTCCTGCATCCTCTGGTT
CATGTGAGTTTACTATTGCGACTAACTTTCTGCAGGTTTAACATAATACATTATTTCTAC
TGTGAAATTTTACAACTGTTCAAAATTTCATGCAATGGTCCATCTATTAACGCACTAATG
ATATTTATTTTTGGTGCTTTTATACAAATACCCACTTTAATGACTATCATAATCTCTTAT
ACTCGTGTGCTCTTTGATATTCTGAAAAAAAAGTCTGAAAAGGGCAGAAGCAAAGCCTTC
TCCACATGCGGCGCCCATCTGCTTTCTGTCTCATTGTACTACGGAACTCTGATCTTCATG
TATGTGCGTCCTGCATCTGGCTTAGCTGAAGACCAAGACAAAGTGTATTCTCTGTTTTAC
ACGATTATAATTCCCCTGCTAAACCCATTTATTTACAGCTTGAGAAATAAAAAAGTCATG
CATGCATTGAGAAGAGTTATAAGGAAG
Conceptual translation MDISEGNKTLVTEFVLTGLTDRPWLHVLFFVVFLVVYLITMVGNLGLIVLIWNDPHLHMP
MYLFLGGLAFSDACTSTSITPRMLVNFLDKTAMISLAECITQFYFFASSATTECFLLVMM
AYDRYVAICNPLLYPVMMSNKLSAQLLSISYVIGFLHPLVHVSLLLRLTFCRFNIIHYFY
CEILQLFKISCNGPSINALMIFIFGAFIQIPTLMTIIISYTRVLFDILKKKSEKGRSKAF
STCGAHLLSVSLYYGTLIFMYVRPASGLAEDQDKVYSLFYTIIIPLLNPFIYSLRNKKVM
HALRRVIRK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
3 100 -100 NS C/A N/K 1000GP (YRI, YRI, YRI, YRI)
3 97,806,163 97,806,162 Ins(1) -/G rs35229249 (DbSNP)
3 97,806,616 97,806,616 NS A/G I/M rs4518168 (DbSNP)
3 97,806,701 97,806,700 Ins(1) -/A rs11369970 (DbSNP)
3 98,087,331 98,087,331 NS C/A N/K 1000GP (CHBJPT)
3 98,087,461 98,087,461 NS G/C A/P 1000GP (CEU)
3 98,087,772 98,087,772 NS G/A M/I 1000GP (CEU, CHBJPT)
3 98,087,898 98,087,898 SYN A/C T/T 1000GP (CEU)

Variations - CNVs

Chr Start End Type Sources
3 97,805,917 97,808,943 CopyNumber #109 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

N53K Q145H M200I V223M % Freq CORP
1 N Q I V 49.69 0.148
2 N Q M V 43.55 0.148
3 K Q M V 2.53 0.148
4 N H M V 1.77 0.148
5 K Q I V 1.46 0.148
6 N Q M M 1.00 0.148

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5AC2.aApr07-unspliced main_exon CDS chr3 98,087,173 98,088,099 +
3UTR chr3 98,088,099 98,088,102 +