Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5AC4P Olfactory Receptor

Gene Symbol OR5AC4P1 (View this gene in GeneCards)
Family 5
Subfamily AC
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR3.3.3P
External Ids HGNC: 31284   GeneBank: NG_004426   
Build #39 labels
Chromosomal location 3:98,104,754-98,105,669 (+)
Cluster 3@98
Synteny CLIC#9
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5AC1P 75.74% 305

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5AC26 79% 303
Mouse Or5ac16 72% 299
Rat Or5ac16 71% 299
Cow OR5AC26 80% 306
Orang OR5AC1 76% 305
Horse OR5AC34 78% 306
Chimp OR5AC1 75% 305

Sequence information

Nucleotide sequence ATGGAAACAAATAAGACACAGATTATGAACTCCGTCCTCCAAGGACTTACAGATCTTCTA
GAGCTGCAGGCGCCCTTGTTCCTGGTGTTCCTGGTGATCTACCTTATCACCACGGTGGGC
AACCGTGGCCTGATGGCTCTCATCTGGAAGGATCCCCACTTTCACACCCCCATGTGCTTA
TCCCTCGGCAGTTTAGCCTTTGCAGATGCATGCACTTCATCTTCTGTGACTCCCAAGATG
TTCGTACATTTTTTATCTAAGAATCATATGATATCCCTGGTTGGGTGCATGATCCAGTTT
TATATTTTTGCTTCCGGTGCAAACACAGGAAGTTTCCTCCTGGTAGTGATGGCCTATGAC
TGTTATATGGCCATATGTAACCCTTTGCTTTATCCTCTAGTGATGTCCAATACCTTCTGC
ATTCAATTATCAGGTGTTTCATTTATTATTGTTTTTTTCATCCTATAACGCATGTGGGTT
TGTTATTTCAATTAACTTTCTGCAAGTCCAATGTAATACATTATTTCTACTGTGATATTT
TACAACTGTTTAAAATTTCCTGTACTGACCCTGGAGTAATATGCTCCTGGTTTTTGTATT
TTCAGTCTTTATACAATCTTTCACTTTTATGACTATCATCGTCTCTTACTCCTATGTCCT
CTTGGCCATCCTGAAAAAGAAGTCTGAGAAGGGTAGAAGGAAAGCTTTCTCCACTTGCAG
TGCCCATCTGCTTTCTGTCTCTTTGTTCTATGGCACTCTCTTCTTCATGTATGTGTGTCC
TGGGTCTGGATCAGCTGCAGATCAGGACAAAATATATTCTTTATTTTACATGATAATAAT
TCCTCTGGTAAATCCTTTTATTTACAGTCTGAGGAATAAAGAGGTCATAGGTGCATTGAA
GAGAATAATAAATAAA
Conceptual translation METNKTQIMNSVLQGLTDLLELQAPLFLVFLVIYLITTVGNRGLMALIWKDPHFHTPMCL
SLGSLAFADACTSSSVTPKMFVHFLSKNHMISLVGCMIQFYIFASGANTGSFLLVVMAYD
CYMAICNPLLYPLVMSNTFCIQLSGVSFII/FFHPITHVGLLFQLTFCKSNVIHYFYCD
ILQLFKISCTDPG/NMLLVFVFSVFIQSFTFMTIIVSYSYVLLAILKKKSEKGRRKAFS
TCSAHLLSVSLFYGTLFFMYVCPGSGSAADQDKIYSLFYMIIIPLVNPFIYSLRNKEVIG
ALKRIINK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
3 100 -100 SNP G/A 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
3 97,823,631 97,823,631 SNP A/G rs58138872 (DbSNP)
3 97,823,838 97,823,838 SNP C/T rs6775533 (DbSNP)
3 97,823,926 97,823,926 SNP A/G rs6786563 (DbSNP)
3 97,824,080 97,824,080 SNP C/T rs13074218 (DbSNP)
3 97,824,181 97,824,181 SNP C/T rs9836845 (DbSNP)
3 97,824,238 97,824,238 SNP A/G rs72922074 (DbSNP)
3 97,824,242 97,824,241 Ins(1) -/T rs71760189 (DbSNP)
3 97,824,348 97,824,348 SNP C/T rs9860633 (DbSNP)
3 98,104,841 98,104,841 SNP T/C 1000GP (CEU)
3 98,104,877 98,104,877 SNP C/T 1000GP (CEU)
3 98,104,994 98,104,994 SNP T/C 1000GP (CEU, CHBJPT)
3 98,105,082 98,105,082 SNP G/A 1000GP (CEU, CHBJPT)
3 98,105,337 98,105,337 SNP C/T 1000GP (CEU, CHBJPT)
3 98,105,394 98,105,394 SNP G/A 1000GP (CEU, CHBJPT)
3 98,105,504 98,105,504 SNP T/C 1000GP (CEU, CHBJPT)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.