Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5AK1P Olfactory Receptor

Gene Symbol OR5AK1P1 (View this gene in GeneCards)
Family 5
Subfamily AK
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-220, HsOR11.11.97P, ORL3570
External Ids HGNC: 15250   GeneBank: BK004783, NG_004213   ORDB: ORL3570   
Build #39 labels OR5AK1P, OR5AK5P
Chromosomal location 11:57,018,091-57,019,018 (+)
Cluster 11@57
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5AK2 89.64% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5AK7 79% 309
Mouse Or5ak25 75% 308
Rat Or5ak25 76% 308
Cow OR5AK7 78% 307
Orang OR5AK1 90% 309
Horse OR5AK35 77% 309
Chimp OR5AK2 90% 309

Sequence information

Nucleotide sequence ATGGCATGAGGAAACAGCACTGAAGTGACTGAATTCTGTCTTCTGGGATTTGGTGCCTAG
CAAGAGTTTTGGTGTATCCTCTTCATTATATTCCTTCTCATCTATGTGACCTCCATAATG
GGTAATAGTGGAATAATCTTACTCATCAACACAGATTCCAGATTTCAAACACCCATGTAC
TTTTTTCTACAACATTTGGCTTTTGTTGATATCTGTTACACTTCTGCTATCACTCCCAAG
ATGCTCCAAAGCTTCACGGAAGAAAAGAATTTGATATCATTTTGGGGCTGCATGATACAA
TTATTGGTTTATGCAACATTTGCAACCAGTGACTGTTATCTCCTGGCTATGATAGCAGTG
GACCATTATGTTGCAATCTGTAAGCCCCTTCACTATACCGTAATCACGTCCCAAACAGTC
TGCATCCATTTGGTAGCTGGTTCATACATCATGGGCTCAATAAATGCCTCTGTACATACA
GGTTTTGCATTTTCACTGTCTTTCTGCAAGTCCAATAACATCAACCACTTTTTCTGTGAT
GGTCCCCCAATTCTTGCCCTTTCATGCTCCAATATTGACATCAACATCATGCTACTTGTT
GTCTTTGTGGGATTTAACTTGATGTTCACTGGGTTGGTAGTCATCTTTTCCTACATCTAC
ATCATGGCCACCATCCTGAAAATGTCTTCTAGTGCAGGAAGGAAAAAATCCTTCTCAACA
TGTGCCTCCCACCTGACCACAGTTGCCATTTTCTATGGGACACTCTCTTACATGCACTTA
CCAGTCTCATTCTAATAATTCCCAGGAGAATATGAAAGTGGCCTCTATATTTTATGGCAC
TGTTATTCCCATGTTGAATCCTTTAATCTATAGCTTGAGAAATAAGGAAGTAAAAGAAGC
TTTAAAATTGATAGGGAAAAAGTTCTTT
Conceptual translation MAXNSTEVTEFCLLGFGAXEFWCILFIIFLLIYVTSIMGNSGIILLINTDSRFQTPMY
FFLQHLAFVDICYTSAITPKMLQSFTEEKNLISFWGCMIQLLVYATFATSDCYLLAMIAV
DHYVAICKPLHYTVITSQTVCIHLVAGSYIMGSINASVHTGFAFSLSFCKSNNINHFFCD
GPPILALSCSNIDINIMLLVVFVGFNLMFTGLVVIFSYIYIMATILKMSSSAGRKKSFST
CASHLTTVAIFYGTLSYMHL\SHSNNSQENMKVASIFYGTVIPMLNPLIYSLRNKEVKE
ALKLIGKKFF

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP A/G 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 56,785,610 56,785,609 Ins(1) -/G rs35451288 (DbSNP)
11 56,785,625 56,785,625 SNP G/T rs10792074 (DbSNP)
11 56,786,219 56,786,219 SNP C/T rs7940765 (DbSNP)
11 56,786,373 56,786,373 SNP A/G rs11228872 (DbSNP)
11 56,786,394 56,786,394 SNP A/G rs12804126 (DbSNP)
11 57,018,150 57,018,150 SNP G/T 1000GP (CEU, CHBJPT)
11 57,018,744 57,018,744 SNP C/T 1000GP (CEU)
11 57,018,919 57,018,919 SNP A/G 1000GP (CEU)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.