Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5AK2 Olfactory Receptor

Gene Symbol OR5AK21 (View this gene in GeneCards)
Family 5
Subfamily AK
Pseudogene No
CORP pseudogene probability score
Aliases HsOR11.11.96, ORL3454
External Ids HGNC: 15251   GeneBank: AB065496, NM_001005323   ORDB: ORL3454   
Build #39 labels OR5AK2
Chromosomal location 11:56,988,914-56,989,840 (+)
Cluster 11@57
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5AK1P 89.64% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5AK7 78% 309
Chimp CONTIG229.94-11154 97% 309
Mouse Or5ak23 76% 305
Rat Or5ak25 76% 307
Cow OR5AK7 79% 307

Expression evidences

Source Accession
ESTs BU102162
mRNA BC137198
GNF Atlas2 gnf1h10679_at

Sequence information

Nucleotide sequence ATGACACTAGGAAACAGCACTGAAGTCACTGAATTCTATCTTCTGGGATTTGGTGCCCAG
CATGAGTTTTGGTGTATCCTCTTCATTGTATTCCTTCTCATCTATGTGACCTCCATAATG
GGTAATAGTGGAATAATCTTACTCATCAACACAGATTCCAGATTTCAAACACTCACGTAC
TTTTTTCTACAACATTTGGCTTTTGTTGATATCTGTTACACTTCTGCTATCACTCCCAAG
ATGCTCCAAAGCTTCACAGAAGAAAAGAATTTGATGTTATTTCAGGGCTGTGTGATACAA
TTCTTAGTTTATGCAACATTTGCAACCAGTGACTGTTATCTCCTGGCTATGATGGCAGTG
GATCCTTATGTTGCCATCTGTAAGCCCCTTCACTATACTGTAATCATGTCCCGAACAGTC
TGCATCCGTTTGGTAGCTGGTTCATACATCATGGGCTCAATAAATGCCTCTGTACAAACA
GGTTTTACATGTTCACTGTCCTTCTGCAAGTCCAATAGCATCAATCACTTTTTCTGTGAT
GTTCCCCCTATTCTTGCTCTTTCATGCTCCAATGTTGACATCAACATCATGCTACTTGTT
GTCTTTGTGGGATCTAACTTGATATTCACTGGGTTGGTCGTCATCTTTTCCTACATCTAC
ATCATGGCCACCATCCTGAAAATGTCTTCTAGTGCAGGAAGGAAAAAATCCTTCTCAACA
TGTGCTTCCCACCTGACCGCAGTCACCATTTTCTATGGGACACTCTCTTACATGTATTTG
CAGTCTCATTCTAATAATTCCCAGGAAAATATGAAAGTGGCCTTTATATTTTATGGCACA
GTTATTCCCATGTTAAATCCTTTAATCTATAGCTTGAGAAATAAGGAAGTAAAAGAAGCT
TTAAAAGTGATAGGGAAAAAGTTATTT
Conceptual translation MTLGNSTEVTEFYLLGFGAQHEFWCILFIVFLLIYVTSIMGNSGIILLINTDSRFQTLTY
FFLQHLAFVDICYTSAITPKMLQSFTEEKNLMLFQGCVIQFLVYATFATSDCYLLAMMAV
DPYVAICKPLHYTVIMSRTVCIRLVAGSYIMGSINASVQTGFTCSLSFCKSNSINHFFCD
VPPILALSCSNVDINIMLLVVFVGSNLIFTGLVVIFSYIYIMATILKMSSSAGRKKSFST
CASHLTAVTIFYGTLSYMYLQSHSNNSQENMKVAFIFYGTVIPMLNPLIYSLRNKEVKEA
LKVIGKKLF

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 56,756,398 56,756,398 nonsense SNP G/T G/* rs13343184 (DbSNP)
11 56,756,915 56,756,915 NS A/G H/R rs62001000 (DbSNP)
11 56,756,664 56,756,664 NS A/G I/M rs2853083 (DbSNP)
11 56,756,516 56,756,516 NS C/G T/S rs12420424 (DbSNP)
11 56,756,399 56,756,399 NS G/T G/V rs10896563 (DbSNP)
11 56,756,565 56,756,565 SYN A/G T/T rs62001001 (DbSNP)
11 56,757,021 56,757,021 SYN A/G G/G rs61886711 (DbSNP)
11 56,989,546 56,989,546 SYN G/A G/G 1000GP (CEU, CHBJPT)
11 56,989,189 56,989,189 NS G/A M/I 1000GP (CEU, CHBJPT)
11 56,988,924 56,988,924 NS G/T G/V 1000GP (CEU, CHBJPT)
11 100 -100 NS G/T G/V 1000GP (YRI, YRI, YRI, YRI)
11 100 -100 SYN G/A T/T 1000GP (YRI, YRI)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

G4V S43T M92I H176R V214I K306T % Freq CORP
1 G S I H V K 52.46 0.998
2 G S M H V K 27.11 0.999
3 V S I H V K 13.82 0.998
4 G T I H V K 4.15 0.998
5 G S I R V K 1.84 0.998
6 G S I H I K 0.31 0.998
7 G S I H V T 0.15 0.998
8 V T I H V K 0.08 0.998
9 G S M R V K 0.08 0.999

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5AK2.aApr07-unspliced main_exon CDS chr11 56,988,914 56,989,840 +
3UTR chr11 56,989,840 56,989,843 +