Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5AP2 Olfactory Receptor

Gene Symbol OR5AP21 (View this gene in GeneCards)
Family 5
Subfamily AP
Pseudogene No
CORP pseudogene probability score 0.41 (functional)
Aliases OR11-146, HsOR11.11.84, ORL3401
External Ids HGNC: 15258   GeneBank: AB065854, BK004594, NM_001002925   ORDB: ORL3401   
Build #39 labels OR5AP2
Chromosomal location 11:56,641,492-56,642,442 (-)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5AP1P 64.9% 302

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5AP1 69% 300
Mouse Or5ap2 86% 317
Rat Or5ap2 84% 317
Rat Or5ap2b 81% 317
Cow OR5AP2P 82% 313
Orang OR9S18 55% 303
Horse OR5AP2C 88% 317
Chimp OR5W2 58% 304

Expression evidences

Source Accession
ESTs BX279705
mRNA BC136990
GNF Atlas2 gnf1h05766_at

Sequence information

Nucleotide sequence ATGATGAGACTTATGAAAGAGGTTCGAGGCAGAAATCAAACAGAAGTAACAGAATTTCTC
CTCTTAGGACTTTCCGACAATCCAGATCTACAAGGAGTCCTCTTTGCATTGTTTCTGTTG
ATCTATATGGCAAACATGGTGGGCAATTTGGGGATGATTGTATTGATTAAGATTGATCTC
TGTCTCCACACCCCCATGTATTTCTTTCTCAGTAGCCTCTCTTTTGTAGATGCCTCTTAC
TCTTCTTCCGTCACTCCCAAGATGCTGGTGAACCTCATGGCTGAGAATAAGGCCATTTCT
TTTCATGGATGTGCTGCCCAGTTCTACTTCTTTGGCTCCTTCCTGGGGACTGAGTGCTTC
CTGTTGGCCATGATGGCATATGACCGCTATGCAGCCATTTGGAACCCCCTGCTCTACCCA
GTTCTCGTGTCTGGGAGAATTTGCTTTTTGCTAATAGCTACCTCCTTCTTAGCAGGTTGT
GGAAATGCAGCCATACATACAGGGATGACTTTTAGGTTGTCCTTTTGTGGTTCTAATAGG
ATCAACCATTTCTACTGTGACACCCCGCCACTGCTCAAACTCTCTTGCTCTGATACCCAC
TTCAATGGCATTGTGATCATGGCATTCTCAAGTTTTATTGTCATCAGCTGTGTTATGATT
GTCCTCATTTCCTACCTGTGTATCTTCATTGCCGTCTTGAAGATGCCTTCGTTAGAGGGC
AGGCACAAAGCCTTCTCCACCTGTGCCTCTTACCTCATGGCTGTCACCATATTCTTTGGA
ACAATCCTCTTCATGTACTTGCGCCCTACATCTAGCTACTCAATGGAGCAAGACAAGGTT
GTCTCTGTCTTTTATACAGTAATAATCCCTGTGCTAAATCCCCTCATCTATAGTTTAAAA
AATAAGGATGTAAAAAAGGCCCTAAAGAAGATCTTATGGAAACACATCTTG
Conceptual translation MMRLMKEVRGRNQTEVTEFLLLGLSDNPDLQGVLFALFLLIYMANMVGNLGMIVLIKIDL
CLHTPMYFFLSSLSFVDASYSSSVTPKMLVNLMAENKAISFHGCAAQFYFFGSFLGTECF
LLAMMAYDRYAAIWNPLLYPVLVSGRICFLLIATSFLAGCGNAAIHTGMTFRLSFCGSNR
INHFYCDTPPLLKLSCSDTHFNGIVIMAFSSFIVISCVMIVLISYLCIFIAVLKMPSLEG
RHKAFSTCASYLMAVTIFFGTILFMYLRPTSSYSMEQDKVVSVFYTVIIPVLNPLIYSLK
NKDVKKALKKILWKHIL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS C/T R/H 1000GP (YRI, YRI)
11 56,409,010 56,409,010 NS A/T D/E rs61747872 (DbSNP)
11 56,409,039 56,409,039 NS T/G T/P rs61742762 (DbSNP)
11 56,409,533 56,409,533 NS T/C H/R rs61743175 (DbSNP)
11 56,409,599 56,409,599 NS T/C Q/R rs61732328 (DbSNP)
11 56,409,603 56,409,603 NS C/T A/T rs11606499 (DbSNP)
11 56,641,534 56,641,534 NS A/T D/E 1000GP (CEU)
11 56,642,127 56,642,127 NS C/T A/T 1000GP (CEU)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

D302E R128H Q106R A105T % Freq CORP
1 D R Q A 82.49 1.000
2 D R Q T 13.44 1.000
3 E R Q A 3.00 1.000
4 D R R A 0.61 1.000
5 D H Q A 0.46 1.000

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5AP2.aApr07-unspliced main_exon 3UTR chr11 56,641,489 56,641,492 -
CDS_partial chr11 56,641,492 56,642,439 -