Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5AQ1P Olfactory Receptor

Gene Symbol OR5AQ1P1 (View this gene in GeneCards)
Family 5
Subfamily AQ
Pseudogene Yes
CORP pseudogene probability score 0.62 (pseudogene)
Aliases OR11-162, OR11-165, HsOR11.11.42P, ORL3576
External Ids HGNC: 15259   GeneBank: AB065451, AB065593, BK004580, BK004708, NG_004208   ORDB: ORL3576   
Build #39 labels OR5AQ1P
Chromosomal location 11:56,054,365-56,055,300 (+)
Cluster 11@56
Synteny CLIC#26
Remarks Full ORF without a suitable ATG

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5J1P 61.46% 301
OR5J2 58.14% 301

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5AQ1 89% 307
Mouse Or5aq1 81% 302
Mouse Or5aq1b 80% 304
Rat Or5aq1 80% 302
Cow OR5AQ8P 78% 254
Orang OR5G1 53% 305
Horse OR5AQ1 83% 310
Horse OR5AQ1E 82% 310
Chimp OR5J1 62% 307

Expression evidences

Source Accession
mRNA AB529247
GNF Atlas2 gnf1h10929_at

Sequence information

Nucleotide sequence ACGAGAGGCTGGAATCATACAGGTGCAAAGGAATTCCTCCTGGTAGGGTTAACTGAAAAT
CCTAATTTGCAGATCCCACTCTTTTTGCTTGTCACTCTGATTTATTTCATCACTTTGTTG
GATAATTTGGGTATAATTATTTTAATCTGGTTAAATGCCCAACTTCATACTCCAATGTAC
TTCTTCCTTGGCAACCTCTCCTTTTGTGATATCTGCTACTCTACTGTCTTTGCTCCTAAG
ATGCTAGTCAATTTCCTATCAAAACATAAGTCCAGTACATTTTCTGGCTGTGTTCTACAG
AGTTTCCCTTTTGCAGTATATGTAACCACAAAGGACATTCTCCTGTCCATGATGGCTTAT
GACCATTACGTGGCCATAGCTAATCCCTTGTTGTATACAGTCATTATGGCCCAAAAAGTT
TGTATTCAGATGGTCCTTGCTTCTTACTTAGGTGGGCTCATTAATTCCCTGACACACACA
ATAGGTTTGCTCAAATTAGACTTCTGTGGTCCTAATATTGTGAATCATTATTTCTGTGAT
GTTCCTCCTCTTCTGAGGCTTTCTTGCTCTGATGCTCATATCAATGAAATGCTGCCCTTG
GTCTTCTCTGGGCTCATTGCAATGTTCACTTTCATTGTCATTATGGTGTCTTATATCTGC
ATCATCATTGCCATCCAGAGAATCCATGCAGCTGAGGGAAGGTACAAAGCCTTCTCCACT
TGTGTCTCCCACCTAACCACGGTGACCTTATTCTATGGGTCTGTTTCTTTTAGTTATATC
CAGCCAAGTTCTCAGTATTCCTTGGAACAGGAGAAGGTCTTGGCTGTGTTTTATACACTG
GTGATCCCCATGCTAAACCCACTTATTTATAGCCTGAGAAATAAGGATGTAAAAGATGCA
GCCAAAAGGTTGATATGGTGGGGGAAAAACCCCACT
Conceptual translation TRGWNHTGAKEFLLVGLTENPNLQIPLFLLVTLIYFITLLDNLGIIILIWLNAQLHTPMY
FFLGNLSFCDICYSTVFAPKMLVNFLSKHKSSTFSGCVLQSFPFAVYVTTKDILLSMMAY
DHYVAIANPLLYTVIMAQKVCIQMVLASYLGGLINSLTHTIGLLKLDFCGPNIVNHYFCD
VPPLLRLSCSDAHINEMLPLVFSGLIAMFTFIVIMVSYICIIIAIQRIHAAEGRYKAFST
CVSHLTTVTLFYGSVSFSYIQPSSQYSLEQEKVLAVFYTLVIPMLNPLIYSLRNKDVKDA
AKRLIWWGKNPT

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP C/T 1000GP (YRI, YRI, YRI, YRI)
11 55,821,842 55,821,842 SNP T/C rs2512747 (DbSNP)
11 55,822,189 55,822,189 SNP A/T rs61729642 (DbSNP)
11 55,822,253 55,822,253 Del(1) -/A rs34252513 (DbSNP)
11 55,822,289 55,822,289 SNP C/T rs61891189 (DbSNP)
11 55,822,479 55,822,479 SNP C/T rs61742523 (DbSNP)
11 55,822,658 55,822,658 SNP A/T rs61746167 (DbSNP)
11 56,054,366 56,054,366 SNP C/T 1000GP (CEU, CHBJPT)
11 56,054,713 56,054,713 SNP A/T 1000GP (CEU)
11 56,054,794 56,054,794 SNP A/G 1000GP (CHBJPT)
11 56,054,813 56,054,813 SNP T/C 1000GP (CEU)
11 56,055,182 56,055,182 SNP T/A 1000GP (CEU)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 169 (Hasin)
11 54,835,623 55,879,426 CopyNumber Variation_8690 (DGV)
11 55,683,109 55,833,490 CopyNumber Variation_85786 (DGV)
11 55,685,556 55,836,620 CopyNumber Variation_48847 (DGV)
11 55,685,799 55,842,512 CopyNumber Variation_9189 (DGV)
11 55,689,863 55,849,156 CopyNumber Variation_2927 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.