Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5AR1 Olfactory Receptor

Gene Symbol OR5AR11 (View this gene in GeneCards)
Family 5
Subfamily AR
Pseudogene No
CORP pseudogene probability score 1 (pseudogene)
Aliases OR11-209, HsOR11.11.85, ORL3399
External Ids HGNC: 15260   GeneBank: AB065740, BK004401, NM_001004730   ORDB: ORL3399   
Build #39 labels OR5AR1
Chromosomal location 11:56,663,686-56,664,615 (+)
Cluster 11@56
Synteny CLIC#26
Remarks Segregating Pseudo Gene, a nonsynonymous SNP rs11228710 (AA change=Q/* )

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5B12 58.55% 304
OR5B21 59.54% 304
OR5W2 56.68% 307

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5AR1 94% 310
Chimp CONTIG229.55-47070 98% 310
Mouse Or5ar1 93% 310
Rat Or5ar1 93% 310
Cow OR5AR1 94% 310

Expression evidences

Source Accession
mRNA BC140745
GNF Atlas2 gnf1h11093_at

Sequence information

Nucleotide sequence ATGGATAAAGAAAACAGCTCAATGGTGACTGAGTTTATCTTCATGGGCATCACCCAGGAC
CCTCAGATGGAGATCATCTTCTTCGTGGTCTTCCTCATAGTTTACCTGGTTAATGTAGTG
GGGAATATTGGTATGATTATCCTGATTACAACAGACACTCAGCTTCACACACCCATGTAT
TTTTTCCTCTGCAACCTCTCCTTTGTTGACCTGGGCTACTCCTCAGCCATTGCCCCCAGG
ATGCTGGCTGACTTCCTAACAAATCACAAAGTTATCTCCTTCTCCAGCTGTGCCACCCAG
TTTGCTTTTTTTGTAGGTTTTGTGGATGCTGAGTGCTATGTCCTGGCAGCCATGGCCTAT
GGTCGTTTTGTGGCCATTTGTCGACCCCTCCACTATAGCACCTTCATGTCCAAGCAGGTC
TGCTTGGCTCTCATGCTGGGCTCTTACCTGGCTGGTCTAGTGAGTTTAGTAGCCCACACT
ACCCTCACCTTCAGCCTGAGTTACTGTGGTTCCAATATCATCAATCATTTCTTCTGCGAA
ATCCCACCACTCTTGGCCCTCTCTTGCTCAGACACCTACATCAGTGAGATCTTGCTCTTC
AGTCTGTGTGGCTTCATTGAATTCAGCACCATCCTCATCATCTTCATCTCCTATACCTTT
ATCCTTGTTGCAATCATCAGAATGCGTTCAGCTGAAGGCCGCCTTAAGGCTTTCTCCACC
TGCGGGTCTCACCTTACTGGCATCACCCTCTTCTATGGCACAGTCATGTTTATGTACCTG
AGGCCAACATCCAGCTACTCCCTGGACCAAGACAAGTGGGCCTCTGTGTTCTACACGGTT
ATCATCCCCATGTTAAATCCCTTGATCTACAGTTTGCGGAACAAGGATGTGAAAGCTGCT
TTCAAAAAGCTAATTGGAAAAAAATCTCAA
Conceptual translation MDKENSSMVTEFIFMGITQDPQMEIIFFVVFLIVYLVNVVGNIGMIILITTDTQLHTPMY
FFLCNLSFVDLGYSSAIAPRMLADFLTNHKVISFSSCATQFAFFVGFVDAECYVLAAMAY
GRFVAICRPLHYSTFMSKQVCLALMLGSYLAGLVSLVAHTTLTFSLSYCGSNIINHFFCE
IPPLLALSCSDTYISEILLFSLCGFIEFSTILIIFISYTFILVAIIRMRSAEGRLKAFST
CGSHLTGITLFYGTVMFMYLRPTSSYSLDQDKWASVFYTVIIPMLNPLIYSLRNKDVKAA
FKKLIGKKSQ

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 56,431,216 56,431,216 nonsense SNP C/T Q/* rs11228710 (DbSNP)
11 56,431,834 56,431,834 NS A/G I/V rs56067375 (DbSNP)
11 56,432,093 56,432,093 NS A/T "*/L,stop loss" rs61740352 (DbSNP)
11 56,431,998 56,431,998 SYN A/G T/T rs61742850 (DbSNP)
11 56,663,740 56,663,740 nonsense SNP C/T Q/* 1000GP (CEU, CHBJPT)
11 56,664,021 56,664,021 SYN C/T C/C 1000GP (CEU)
11 56,664,142 56,664,142 SYN C/T L/L 1000GP (CEU)
11 56,663,911 56,663,911 NS G/A A/T 1000GP (CEU)
11 56,664,358 56,664,358 NS A/G I/V 1000GP (CEU, CHBJPT)
11 56,664,065 56,664,065 NS G/T C/F 1000GP (CHBJPT)
11 56,664,191 56,664,191 NS G/A C/Y 1000GP (CHBJPT)
11 56,664,432 56,664,432 SYN C/T T/T 1000GP (CHBJPT)
11 100 -100 nonsense SNP C/T Q/* 1000GP (YRI)
11 100 -100 NS A/G I/V 1000GP (YRI, YRI)
11 100 -100 SYN G/A T/T 1000GP (YRI)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

Q19* C169Y I225V R293W % Freq CORP
1 * C I R 58.53 1.200
2 Q C I R 34.10 1.000
3 Q C V R 3.99 1.000
4 * Y I R 3.15 1.200
5 * C V R 0.08 1.200
6 Q C I W 0.08 1.000
7 Q Y I R 0.08 1.000

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5AR1.aApr07-unspliced main_exon CDS chr11 56,663,686 56,664,615 +
3UTR chr11 56,664,615 56,664,618 +