Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5AU1 Olfactory Receptor

Gene Symbol OR5AU11 (View this gene in GeneCards)
Family 5
Subfamily AU
Pseudogene No
CORP pseudogene probability score
Aliases OR14-38, HsOR14.2.1, ORL3340
External Ids HGNC: 15362   GeneBank: AB065898, AF399635, BK004520, NM_001004731   ORDB: ORL3340   
Build #39 labels OR5AU1
Chromosomal location 14:21,154,940-21,155,872 (-)
Cluster 14@22a
Synteny CLIC#34
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5AP2 54.61% 304
OR5AR1 54.05% 309
OR8D1 55.67% 300

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5AP1 58% 302
Mouse Or5au1 85% 310
Rat Or5au1 87% 311
Cow OR5AR1 55% 308
Orang OR8D4 55% 308
Horse OR8D4 55% 309
Chimp OR5AP2 55% 306

Expression evidences

Source Accession
mRNA BC137304
GNF Atlas2 gnf1h02181_at
GNF Atlas2 gnf1h11227_s_at

Sequence information

Nucleotide sequence ATGAAAGGGGCAAACCTGAGCCAAGGGATGGAGTTTGAGCTCTTGGGCCTCACCACTGAC
CCCCAGCTCCAGAGGCTGCTCTTCGTGGTGTTCCTGGGCATGTACACAGCCACTCTGCTG
GGGAACCTGGTCATGTTCCTCCTGATCCATGTGAGTGCCACCCTGCACACACCCATGTAC
TCCCTCCTGAAGAGCCTCTCCTTCTTGGATTTCTGCTACTCCTCCACGGTTGTGCCCCAG
ACCCTGGTGAACTTCTTGGCCAAGAGGAAAGTGATCTCTTATTTTGGCTGCATGACTCAG
ATGTTCTTCTATGCGGGTTTTGCCACCAGTGAGTGCTATCTCATCGCTGCCATGGCCTAT
GACCGCTATGCCGCTATTTGTAACCCCCTGCTCTACTCAACCATCATGTCTCCTGAGGTC
TGTGCCTCGCTGATTGTGGGCTCCTACAGTGCAGGATTCCTCAATTCTCTTATCCACACT
GGCTGTATCTTTAGTCTGAAATTCTGCGGTGCTCATGTCGTCACTCACTTCTTCTGTGAT
GGGCCACCCATCCTGTCCTTGTCTTGTGTAGACACCTCACTGTGTGAGATCCTGCTCTTC
ATTTTTGCTGGTTTCAACCTTTTGAGCTGCACCCTCACCATCTTGATCTCCTACTTCTTA
ATTCTCAACACCATCCTGAAAATGAGCTCGGCCCAGGGCAGGTTTAAGGCATTTTCCACC
TGTGCATCCCACCTCACTGCCATCTGCCTCTTCTTTGGCACAACACTTTTTATGTACCTG
CGCCCCAGGTCCAGCTACTCCTTGACCCAGGACCGCACAGTTGCTGTCATCTACACAGTG
GTGATCCCAGTGCTGAACCCCCTCATGTACTCTTTGAGAAACAAGGATGTGAAGAAAGCT
TTAATAAAGGTTTGGGGTAGGAAAACAATGGAA
Conceptual translation MKGANLSQGMEFELLGLTTDPQLQRLLFVVFLGMYTATLLGNLVMFLLIHVSATLHTPMY
SLLKSLSFLDFCYSSTVVPQTLVNFLAKRKVISYFGCMTQMFFYAGFATSECYLIAAMAY
DRYAAICNPLLYSTIMSPEVCASLIVGSYSAGFLNSLIHTGCIFSLKFCGAHVVTHFFCD
GPPILSLSCVDTSLCEILLFIFAGFNLLSCTLTILISYFLILNTILKMSSAQGRFKAFST
CASHLTAICLFFGTTLFMYLRPRSSYSLTQDRTVAVIYTVVIPVLNPLMYSLRNKDVKKA
LIKVWGRKTME

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
14 100 -100 NS C/T V/M 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
14 100 -100 SYN G/T S/S 1000GP (YRI, YRI, YRI, YRI, YRI)
14 21,155,131 21,155,131 NS T/C I/V 1000GP (CEU, CHBJPT)
14 21,155,144 21,155,144 SYN G/T S/S 1000GP (CEU, CHBJPT)
14 21,155,330 21,155,330 SYN C/T G/G 1000GP (CEU, CHBJPT)
14 21,155,489 21,155,489 SYN G/A N/N 1000GP (CEU, CHBJPT)
14 21,155,561 21,155,561 SYN A/G Y/Y 1000GP (CHBJPT)
14 21,155,677 21,155,677 NS G/A L/F 1000GP (CEU, CHBJPT)
14 21,155,767 21,155,767 NS T/G T/P 1000GP (CHBJPT)
14 21,623,182 21,623,182 NS T/C M/V rs61755187 (DbSNP)
14 21,623,290 21,623,290 NS C/T V/I rs7145814 (DbSNP)
14 21,623,303 21,623,303 SYN G/T S/S rs45603634 (DbSNP)
14 21,623,316 21,623,316 NS C/G C/S rs61731830 (DbSNP)
14 21,623,363 21,623,363 NS C/G K/N rs57985939 (DbSNP)
14 21,623,484 21,623,484 NS G/A P/L rs61734144 (DbSNP)
14 21,623,489 21,623,489 SYN C/T G/G rs45462402 (DbSNP)
14 21,623,552 21,623,551 Ins(1) -/C rs34047185 (DbSNP)
14 21,623,593 21,623,593 NS T/C S/G rs61741859 (DbSNP)
14 21,623,604 21,623,604 NS A/G L/S rs59120409 (DbSNP)
14 21,623,648 21,623,648 SYN A/G N/N rs7161544 (DbSNP)
14 21,623,676 21,623,676 NS G/A A/V rs61744073 (DbSNP)
14 21,623,680 21,623,680 NS T/C M/V rs61745323 (DbSNP)
14 21,623,836 21,623,836 NS A/G F/L rs4982419 (DbSNP)
14 21,623,924 21,623,924 SYN G/T T/T rs17102038 (DbSNP)
14 21,623,947 21,623,947 NS C/T V/M rs17102042 (DbSNP)
14 21,623,975 21,623,975 SYN A/T T/T rs45570932 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
14 21,621,099 21,624,131 Deletion #239 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

V335M I299V N274K P234L G198S S194L R173H A170V L117F V80M % Freq CORP
1 V V N P G S R A F V 57.60 0.114
2 V I N P G S R A L V 25.27 0.114
3 V V N P G S R A L V 5.22 0.114
4 V I N P G S R A F V 2.69 0.114
5 M V N P G S R A F V 2.61 0.114
6 V V N P G S R V L V 2.30 0.114
7 M V N P G S R A L V 1.31 0.114
8 V V K P G L R A F M 1.31 0.114
9 V V N L G S R A F V 0.31 0.114
10 V V N L G S R A L V 0.23 0.114
11 V I N P G S R V L V 0.23 0.114
12 M V N P G S R V L V 0.15 0.114
13 M V N L G S R A F V 0.15 0.114
14 V V N L G L R A F V 0.15 0.114
15 V V N P G L R A F V 0.08 0.114
16 V V K P S L R A F M 0.08 0.114
17 M V N P G L R A L V 0.08 0.114
18 V V N P S S R A F V 0.08 0.114
19 V I N P G S H A L V 0.08 0.114
20 V V N P G S H A F V 0.08 0.114

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5AU1.aApr07-unspliced main_exon 3UTR chr14 21,154,937 21,154,940 -
CDS chr14 21,154,940 21,155,872 -
5UTR chr14 21,155,872 21,156,025 -