Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5B10P Olfactory Receptor

Gene Symbol OR5B10P1 (View this gene in GeneCards)
Family 5
Subfamily B
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-235, OR13-34, OR13-64, OR13-64, OR13-67, OR13-67, HsOR11.12.16P, ORL3680
External Ids HGNC: 8320   GeneBank: BK004763, NG_002306, U86221, U86223   ORDB: ORL3680   
Build #39 labels OR5B10P, OR5B18P
Chromosomal location 11:58,348,988-58,349,628 (-)
Cluster 11@58
Synteny CLIC#27
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5B2 76.19% 210

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5B2 74% 210
Mouse Or5b3 68% 206
Rat Or5b106 66% 211
Cow OR5B2 72% 210
Orang OR5B135P 94% 211
Orang OR5B153P 93% 211
Horse OR5B2 75% 210
Chimp OR5B3 70% 210

Sequence information

Nucleotide sequence TACTTAACTGTCACTCCCAGGGTCACGGCTAGCAGGGCTAGGTTACTTAGAGGGTAGGAG
GCTAAGTTCCTCGTACAATGCTTGTGCTGCTCAGATGTTCTTTTTTGTAGCCTTGGCCAC
AGTGGAAAATATCGCTGTTGACATCAATGGCCTATGACCACTATATAGCAGTGTGCAAAC
CCCTACACTACACTACCACCACGATAGCCAGTGTATGTGCTCATCTGGTCATAGGCTCCT
ATGTCTGTGGCTTTCTAAATGCCTCCCTCCGCATTGGGGACATATTCAGTCTCTCTTTCT
GTAAGTCCAATCTTGTCCATCACCTTTTCTGTGATGTTCCACCAGTCATGGCTGTGTCTT
GCTCTGGTAAACACATTAGCAAGAAGATTCTGGTTTTTATGTCAAGCTTCAATGTCTTTT
TGGCTCTTCTAGTTATCTTGACCTCCTACCTGTTCATATTCATCACCATCTTGAAGATGC
ACTCAGCTCAGGGACACTTAAAAGCTTTGTCCACCTGTGCCTCTCACCTCATTGCAGTCT
CCATCTTCTATGGAACTACTATCTTTATGCACTTACAGCCTAGCTCCAGCCATTCCATGG
ACACAGATGAAATGGCATCCTTGTTCTATGCTGTGTTCATC
Conceptual translation YLTVTPRVTASR\GYLEGRRLSSSYNACAAQMFFFVALATVENI\LTSMAYDHYIAVC
KPLHYTTTTIASVCAHLVIGSYVCGFLNASLRIGDIFSLSFCKSNLVHHLFCDVPPVMAV
SCSGKHISKKILVFMSSFNVFLALLVILTSYLFIFITILKMHSAQGHLKALSTCASHLIA
VSIFYGTTIFMHLQPSSSHSMDTDEMASLFYAVFI

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP G/A 1000GP (YRI, YRI, YRI)
11 58,116,532 58,116,532 SNP G/A rs1938637 (DbSNP)
11 58,116,570 58,116,570 SNP A/G rs73484175 (DbSNP)
11 58,349,059 58,349,059 SNP G/A 1000GP (CEU, CHBJPT)
11 58,349,314 58,349,314 SNP C/A 1000GP (CHBJPT)
11 58,349,359 58,349,359 SNP G/A 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 126 (Hasin)
11 58,114,461 58,117,201 CopyNumber #75 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.