Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5B12 Olfactory Receptor

Gene Symbol OR5B121 (View this gene in GeneCards)
Family 5
Subfamily B
Pseudogene No
CORP pseudogene probability score 0.25 (functional)
Aliases OR11-241, HsOR11.12.22
External Ids HGNC: 15432   GeneBank: AB065851, AF399637, BK004507, NM_001004733   
Build #39 labels OR5B12P, OR5B16
Chromosomal location 11:58,439,210-58,440,151 (-)
Cluster 11@58
Synteny CLIC#27
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5B1P 71.29% 310
OR5B2 73.29% 307
OR5B3 74.36% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5B12 83% 314
Chimp CONTIG229.271-5680 97% 315
Mouse Or5b12 81% 314
Mouse Or5b12b 81% 314
Rat Or5b12 81% 313
Cow OR5B12 84% 313
Cow OR5B12C 83% 314

Expression evidences

Source Accession
mRNA BC136947
GNF Atlas2 gnf1h02108_at

Sequence information

Nucleotide sequence ATGGAGAACAACACAGAGGTGACTGAATTCATCCTTGTGGGGTTAACTGATGACCCAGAA
CTGCAGATCCCACTCTTCATAGTCTTCCTTTTCATCTACCTCATCACTCTGGTTGGGAAC
CTGGGGATGATTGAATTGATTCTACTGGACTCCTGTCTCCACACCCCCATGTACTTCTTC
CTCAGTAACCTCTCCCTGGTGGACTTTGGTTATTCCTCAGCTGTCACTCCCAAGGTGATG
GTGGGGTTTCTCACAGGAGACAAATTCATATTATATAATGCTTGTGCCACACAATTCTTC
TTCTTTGTAGCCTTTATCACTGCAGAAAGTTTCCTCCTGGCATCAATGGCCTATGACCGC
TATGCAGCATTGTGTAAACCCCTGCATTACACCACCACCATGACAACAAATGTATGTGCT
TGCCTGGCCATAGGCTCCTACATCTGTGGTTTCCTGAATGCATCCATTCATACTGGGAAC
ACTTTCAGGCTCTCCTTCTGTAGATCCAATGTAGTTGAACACTTTTTCTGTGATGCTCCT
CCTCTCTTGACTCTCTCATGTTCAGACAACTACATCAGTGAGATGGTTATTTTTTTTGTG
GTGGGATTCAATGACCTCTTTTCTATCCTGGTAATCTTGATCTCCTACTTATTTATATTT
ATCACCATCATGAAGATGCGCTCACCTGAAGGACGCCAGAAGGCCTTTTCTACTTGTGCT
TCCCACCTTACTGCAGTTTCCATCTTTTATGGGACAGGAATCTTTATGTACTTACGACCT
AACTCCAGCCATTTCATGGGCACAGACAAAATGGCATCTGTGTTCTATGCCATAGTCATT
CCCATGTTGAATCCACTGGTCTACAGCCTGAGGAACAAAGAGGTTAAGAGTGCCTTTAAA
AAGACTGTAGGGAAGGCAAAGGCCTCTATAGGATTCATATTT
Conceptual translation MENNTEVTEFILVGLTDDPELQIPLFIVFLFIYLITLVGNLGMIELILLDSCLHTPMYFF
LSNLSLVDFGYSSAVTPKVMVGFLTGDKFILYNACATQFFFFVAFITAESFLLASMAYDR
YAALCKPLHYTTTMTTNVCACLAIGSYICGFLNASIHTGNTFRLSFCRSNVVEHFFCDAP
PLLTLSCSDNYISEMVIFFVVGFNDLFSILVILISYLFIFITIMKMRSPEGRQKAFSTCA
SHLTAVSIFYGTGIFMYLRPNSSHFMGTDKMASVFYAIVIPMLNPLVYSLRNKEVKSAFK
KTVGKAKASIGFIF

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 58,207,429 58,207,428 Ins(1) -/G rs34206261 (DbSNP)
11 58,207,204 58,207,204 NS A/G C/R rs4938895 (DbSNP)
11 58,207,203 58,207,203 NS C/T C/Y rs11229457 (DbSNP)
11 58,207,567 58,207,567 NS C/T E/K rs11229458 (DbSNP)
11 58,439,241 58,439,241 NS C/T G/E 1000GP (CEU)
11 58,439,731 58,439,731 NS A/G C/R 1000GP (CEU, CHBJPT)
11 58,439,230 58,439,230 NS C/T A/T 1000GP (CEU)
11 58,440,137 58,440,137 SYN T/A T/T 1000GP (CEU)
11 58,439,730 58,439,730 NS C/T C/Y 1000GP (CEU, CHBJPT)
11 100 -100 NS C/T C/Y 1000GP (YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 205 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

A308T G304E R259* C141Y C141R D87E I44T % Freq CORP
1 A G R C R D I 76.27 0.384
2 A G R Y R D I 21.20 0.384
3 T G R C R D I 0.69 0.384
4 A E R C R D I 0.69 0.384
5 A G R C R E I 0.46 0.384
6 A G R C R D T 0.46 0.384
7 A G * C R D I 0.15 1.200
8 A G R C C D I 0.08 0.384

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5B12.aApr07-unspliced main_exon 3UTR chr11 58,439,207 58,439,210 -
CDS chr11 58,439,210 58,440,151 -