Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5B15P Olfactory Receptor

Gene Symbol OR5B15P1 (View this gene in GeneCards)
Family 5
Subfamily B
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-238, HsOR11.12.19P, ORL3619
External Ids HGNC: 15265   GeneBank: BK004718, NG_004206   ORDB: ORL3619   
Build #39 labels OR5B15P
Chromosomal location 11:58,387,571-58,388,486 (-)
Cluster 11@58
Synteny CLIC#27
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5B17 62.83% 304
OR5B1P 61.33% 300
OR5B2 61.49% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5B31 65% 309
Chimp CONTIG229.260-449 64% 304
Chimp CONTIG229.261-6027 63% 299
Mouse Or5b113 60% 304
Rat Or5b114 59% 305
Cow OR5B140 65% 314

Sequence information

Nucleotide sequence TCTCAAACCACATCTATAGATGATAATACAGAGGTAAATGAATTCATATGACTAGGACTA
ACCAAAGCCCCAGAACTACAGGTCCACCTCTTTGTCTTATTTAACTTCATCTACCTCTTC
ACTCTGAGTGGGAACCTGGGGATGATGCTGCTGATCCTGCTGGACTCTCGTCTCCACACT
TCCATGTACTTTTTCCTCAGTAACCTGTCTCTGGTGGACTTTTGCTACTCAGAAACTGTC
ACTCCAAAGATGATGGCTGGGTTGCTGATAGCTCACAAGGTCATCTCCTACAATGTATGT
GCTGCTCAGATGTTCTTTTTTGCAGTCTTTGCTACTGTGGAAAGTTACTTCTTGACTTCA
GTGGCCTATGATTGCTACAGAGTAATGTGTAAACCCCTACATTACACCACCACCATGACA
ACAAATGTGTGTGCTTCTCTGGCCATACATGCATGTCTTAGGTTTACTGACTGCTGCTGT
TGACATTGGAGACATTTTATGTCCAATGAGATCCATCACTTTTTCTGTGATATTCTGGCA
GTCATGACTCTGACTTGCTCTAATAAACATATTAATGAGTTGATCCTTGTTCCTACTTCA
AGCTATATTTTTTACCCTCCTAGTTATCTTGATTTCCTGCTTGTTTGTATTTGTATTTGT
CACCATTTTAAAGATGCTCTCTTTAAGTATACAAGAAGGTTTTATCTACCTATGGTTCTC
ACCTCACTGCAGTTCCTTTATTTTATGAGACTGTCCTCATCACATATGTGCAGCCAAGTT
CTATCATTTCATGAACACAGAAAAAATTGTATCTGTGTTTCATATTATGGTTATCCCCAT
GCTAATCCCTGTGGTTTATAGCCTGAGAAACAACGAGGTCAAGAGTGCATTCAAGACTGT
TTGTTGAGGAAACAAA
Conceptual translation SQTTSIDDNTEVNEFIXGLTKAPELQVHLFVLFNFIYLFTLSGNLGMMLLILLDSRLHT
SMYFFLSNLSLVDFCYSETVTPKMMAGLLIAHKVISYNVCAAQMFFFAVFATVESYFLTS
VAYDCYRVMCKPLHYTTTMTTNVCASLAIHA\LGLLTAAVDIGDI/MSNEIHHFFCDI
LAVMTLTCSNKHINELIL\LLQAIFFTLLVILISCLFVFVFVTILKMLS/KYT/KVL
STYGSHLTAVPLFYETVLITYVQPSS/HFMNTEKIVSVFHIMVIPMLIPVVYSLRNNEV
KSAFKTVCXNK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP T/C 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 58,155,049 58,155,049 SNP C/T rs7934419 (DbSNP)
11 58,155,086 58,155,086 SNP A/G rs10792166 (DbSNP)
11 58,155,500 58,155,499 Ins(1) -/T rs34347092 (DbSNP)
11 58,155,512 58,155,512 SNP A/G rs35769608 (DbSNP)
11 58,155,716 58,155,716 SNP A/G rs73485922 (DbSNP)
11 58,155,809 58,155,809 SNP A/G rs10792167 (DbSNP)
11 58,155,907 58,155,907 SNP A/G rs73485926 (DbSNP)
11 58,387,576 58,387,576 SNP T/C 1000GP (CEU, CHBJPT)
11 58,387,613 58,387,613 SNP G/A 1000GP (CEU, CHBJPT)
11 58,388,039 58,388,039 SNP G/A 1000GP (CEU)
11 58,388,336 58,388,336 SNP G/A 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 173 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.