Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5B19P Olfactory Receptor

Gene Symbol OR5B19P1 (View this gene in GeneCards)
Family 5
Subfamily B
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR11.12.15P, ORL3629
External Ids HGNC: 15269   GeneBank: NG_004205   ORDB: ORL3629   
Build #39 labels OR5B19P
Chromosomal location 11:58,343,813-58,344,670 (-)
Cluster 11@58
Synteny CLIC#27
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5B1P 70% 310
OR5B2 64.17% 307
OR5B3 68.49% 311

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5B2B 68% 311
Chimp CONTIG229.257-2203 97% 310
Mouse Or5b3 65% 307
Rat Or5b104 65% 307
Cow OR5B141 67% 311

Sequence information

Nucleotide sequence ATGTAGAACAGTAGAGAGGCGTCACAGTTCATCTTCCTAGGACTAAGCAATGTCCCAGAA
CTGCAGGTCCCCTTCTTTATCATGTTTGTTCTCATCTATCTCATCAATGTAGTTGGAAAC
TTGGGGATGATCATTTTGATTCTCTGGTACTCTCAGCTCCACAATCCAATGTACTTCTTC
TTCAGTAATCTGTCTCTGGTAGACTTTTTTTACTCTTCAGTTGTCACTCCAAAGGTCATG
ACTGGGCTCCTTAGAGAAGACAAAATCATTTCCTATACTGTGTGGGCTACTCAGACATTC
TTTTCTGATTCCTTTGCCAGTGTGGTAAATTTATTATTGGCCTTAATGGCCTCTGGCCAC
TATGCAGCAGTGTGCAAACCCCTGCATTACACCACCACCATGATGACAAGTGTGTGTACA
TGTCTGGCCATAGGTTGATACGTTGGTGGTTTCCTGAATGCCTCCATTCACACTGGGGAA
ACATTCAGTCTCTTTCTGTATGTCCAGTGAAGTCCATCACTTTTTCTGTGAGGTTCCAGC
AGTCATGGCTCTGTCTTGCTCTGATAGACATGTGAATGTAGTGGTTCTTGTTTATGTAAC
CAGCTCAATATCCTCTTTGCCCTTCTAGTTATCTTGATATCCTACTTATTGATGTTTATC
ACCATCCTAAAGATGCACTCAACTGCAGGATACCAGAAGGCTTTGGCCATTTGTGCCTCT
CACCTCACTGCAGTTGCCATCTTCTATGGGACTATTATCTTCATGCATATACAGCCCAGC
TCCAGTCATTCCATTGACACAGACAAAATTGCAGCTGTGTTTTATACTATTGTCTTCCCC
ATGGTGAACCATGTGGTC
Conceptual translation MXSREASQFIFLGLSNVPELQVPFFIMFVLIYLINVVGNLGMIILILWYSQLHNPMYFF
FSNLSLVDFFYSSVVTPKVMTGLLREDKIISYTVWATQTFFSDSFASVVNLLLALMASGH
YAAVCKPLHYTTTMMTSVCTCLAIGXVGGFLNASIHTGETFSLF\MSSEVHHFFCEVP
AVMALSCSDRHVNVVVLVYVTS/NILFALLVILISYLLMFITILKMHSTAGYQKALAIC
ASHLTAVAIFYGTIIFMHIQPSSSHSIDTDKIAAVFYTIVFPMVNHVVXLKNKVKSTFK
KIVEKVKLSLGL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP A/C 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 58,111,308 58,111,308 SNP C/A rs746248 (DbSNP)
11 58,111,388 58,111,388 SNP A/T rs12786471 (DbSNP)
11 58,111,411 58,111,411 SNP C/T rs12283108 (DbSNP)
11 58,111,513 58,111,513 SNP C/T rs1938648 (DbSNP)
11 58,111,700 58,111,700 SNP A/G rs11229371 (DbSNP)
11 58,112,130 58,112,130 SNP A/C rs1938649 (DbSNP)
11 58,343,835 58,343,835 SNP A/C 1000GP (CEU, CHBJPT)
11 58,344,040 58,344,040 SNP T/C 1000GP (CEU, CHBJPT)
11 58,344,141 58,344,141 SNP C/T 1000GP (CEU)
11 58,344,227 58,344,227 SNP A/G 1000GP (CEU, CHBJPT)
11 58,344,573 58,344,573 SNP T/C 1000GP (CHBJPT)
11 58,344,657 58,344,657 SNP C/A 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 185 (Hasin)
11 58,109,286 58,112,243 CopyNumber #74 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.