Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5B2 Olfactory Receptor

Gene Symbol OR5B21 (View this gene in GeneCards)
Family 5
Subfamily B
Pseudogene No
CORP pseudogene probability score 0.01 (functional)
Aliases OR11-240, OST073, HsOR11.12.21, ORL3451
External Ids HGNC: 8323   GeneBank: AB065852, AF399636, BK004505, NM_001005566   ORDB: ORL3451   
Build #39 labels OR5B2
Chromosomal location 11:58,422,335-58,423,261 (-)
Cluster 11@58
Synteny CLIC#27
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5B12 73.29% 307
OR5B1P 75.9% 307
OR5B3 77.2% 307

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5B2 82% 308
Dog OR5B2B 80% 307
Chimp CONTIG229.261-6027 76% 307
Chimp CONTIG229.271-5680 73% 308
Chimp CONTIG229.260-449 72% 307
Mouse Or5b3 76% 307
Rat Or5b99 74% 306
Cow OR5B141 78% 308

Expression evidences

Source Accession
mRNA BC136923

Sequence information

Nucleotide sequence ATGGAGAATTGTACGGAAGTGACAAAGTTCATTCTTCTAGGACTAACCAGTGTCCCAGAA
CTACAGATCCCCCTCTTTATCTTGTTCACCTTCATCTACCTCCTCACTCTGTGTGGGAAC
CTGGGGATGATGTTGCTGATCCTGATGGACTCTTGTCTCCACACCCCCATGTACTTTTTC
CTCAGTAACCTGTCTCTGGTGGACTTTGGATACTCCTCAGCTGTCACTCCCAAGGTCATG
GCTGGGTTCCTTAGAGGAGACAAGGTCATCTCCTACAATGCATGTGCTGTTCAGATGTTC
TTCTTTGTAGCCTTGGCCACGGTGGAAAATTACTTGTTGGCCTCAATGGCCTATGACCGC
TATGCAGCAGTGTGCAAACCCCTACACTACACCACCACCATGACGGCCAGTGTAGGTGCC
TGTCTGGCCCTAGGCTCATATGTCTGTGGCTTCCTAAATGCCTCATTCCACATTGGGGGC
ATATTCAGTCTCTCTTTCTGTAAATCCAATCTGGTACATCACTTTTTCTGTGATGTTCCA
GCAGTCATGGCTCTGTCTTGCTCTGATAAACACACTAGTGAGGTGATTCTGGTTTTTATG
TCAAGCTTTAATATCTTTTTTGTTCTTCTAGTTATCTTTATCTCCTACTTGTTCATATTC
ATCACCATCTTGAAGATGCATTCAGCTAAGGGACACCAAAAAGCATTGTCCACCTGTGCC
TCTCACTTCACTGCAGTCTCCGTCTTCTATGGGACAGTAATCTTCATCTACTTGCAGCCC
AGCTCCAGCCACTCCATGGACACAGACAAAATGGCATCTGTGTTCTATGCTATGATCATC
CCCATGCTGAACCCTGTGGTCTACAGCCTGAGGAACAGAGAAGTCCAGAATGCATTCAAG
AAAGTGTTGAGAAGGCAAAAATTTCTA
Conceptual translation MENCTEVTKFILLGLTSVPELQIPLFILFTFIYLLTLCGNLGMMLLILMDSCLHTPMYFF
LSNLSLVDFGYSSAVTPKVMAGFLRGDKVISYNACAVQMFFFVALATVENYLLASMAYDR
YAAVCKPLHYTTTMTASVGACLALGSYVCGFLNASFHIGGIFSLSFCKSNLVHHFFCDVP
AVMALSCSDKHTSEVILVFMSSFNIFFVLLVIFISYLFIFITILKMHSAKGHQKALSTCA
SHFTAVSVFYGTVIFIYLQPSSSHSMDTDKMASVFYAMIIPMLNPVVYSLRNREVQNAFK
KVLRRQKFL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 58,190,354 58,190,353 Ins(1) -/G rs71977119 (DbSNP)
11 58,190,136 58,190,136 NS A/G M/T rs4298923 (DbSNP)
11 58,190,112 58,190,112 NS A/G V/A rs10466659 (DbSNP)
11 58,190,414 58,190,414 SYN C/T T/T rs73485945 (DbSNP)
11 58,422,639 58,422,639 NS A/G V/A 1000GP (CEU, CHBJPT)
11 58,422,663 58,422,663 NS A/G M/T 1000GP (CEU, CHBJPT)
11 58,422,942 58,422,942 NS G/A T/M 1000GP (CHBJPT)
11 100 -100 NS A/G V/A 1000GP (YRI, YRI, YRI, YRI)
11 100 -100 SYN G/A S/S 1000GP (YRI)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 191 (Hasin)
11 58,187,808 58,190,834 CopyNumber #76 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

V208A M200T T192S T107M L53I % Freq CORP
1 V M T T L 52.30 0.023
2 A T T T L 21.35 0.050
3 V T T T L 20.66 0.023
4 V T T T I 4.53 0.111
5 V T T M L 0.69 0.023
6 V T S T L 0.46 0.023

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5B2.aApr07-unspliced main_exon 3UTR chr11 58,422,332 58,422,335 -
CDS chr11 58,422,335 58,423,261 -