Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5B21 Olfactory Receptor

Gene Symbol OR5B211 (View this gene in GeneCards)
Family 5
Subfamily B
Pseudogene No
CORP pseudogene probability score 0.08 (functional)
Aliases HsOR11.12.23
External Ids HGNC: 19616   GeneBank: XM_166926   
Build #39 labels OR5B21
Chromosomal location 11:58,507,179-58,508,105 (-)
Cluster 11@58
Synteny CLIC#27
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5B12 71.48% 305
OR5B1P 67.87% 305
OR5B2 68.2% 305

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5B21 84% 309
Chimp CONTIG229.281-20801 96% 311
Mouse Or5b21 86% 308
Rat Or5b21 85% 309
Cow OR5B12 67% 305

Expression evidences

Source Accession
GNF Atlas2 gnf1h11122_at

Sequence information

Nucleotide sequence ATGGAGAATAGCACAGAAGTGACAGAGTTTATCCTCTTGGGATTAACAGATGACCCCAAT
CTTCAGATACCCCTCCTCCTGGCATTTTTATTCATCTACCTCATCACCCTGCTTGGGAAT
GGGGGAATGATGGTGATCATCCACTCAGACTCCCATCTCCACACTCCAATGTACTTTTTC
CTCAGTAACCTCTCCCTTGTAGACTTGGGTTACTCATCAGCTGTAGCCCCCAAAACGGTG
GCTGCATTGCGGTCAGGGGACAAGGCCATCTCCTACGATGGATGTGCAGCTCAGTTCTTC
TTCTTTGTGGGGTTTGCCACTGTTGAGTGCTACCTCCTGGCCTCCATGGCCTATGATCGC
CATGCAGCGGTATGTAGGCCTCTTCATTACACCACCACCATGACAGCAGGTGTGTGTGCC
CTCCTTGCTACTGGTTCCTATGTCTCTGGCTTCCTCAATGCCTCTATCCATGCAGCAGGC
ACCTTCAGACTCTCCTTCTGTGGTTCTAATGAGATTAATCATTTCTTCTGTGACATTCCC
CCACTCCTGGCTCTCTCATGCTCTGACACACGCATCAGCAAGTTGGTGGTCTTTGTGGCA
GGCTTCAACGTCTTTTTCACCCTCCTGGTCATCCTTATTTCTTACTTCTTCATATGCATC
ACCATTCAGAGGATGCATTCTGCTGAAGGGCAGAAGAAAGTCTTCTCCACCTGTGCTTCC
CATCTCACTGCTTTGTCCATCTTCTATGGCACAATCATCTTCATGTACTTACAGCCCAAC
TCCAGCCAGTCCGTGGACACAGACAAAATAGCCTCTGTGTTTTACACAGTGGTGATTCCC
ATGCTGAATCCCTTGATATACAGCCTTAGGAACAAAGAAGTGAAAAGTGCTCTCTGGAAA
ATACTCAACAAACTTTACCCCCAATAT
Conceptual translation MENSTEVTEFILLGLTDDPNLQIPLLLAFLFIYLITLLGNGGMMVIIHSDSHLHTPMYFF
LSNLSLVDLGYSSAVAPKTVAALRSGDKAISYDGCAAQFFFFVGFATVECYLLASMAYDR
HAAVCRPLHYTTTMTAGVCALLATGSYVSGFLNASIHAAGTFRLSFCGSNEINHFFCDIP
PLLALSCSDTRISKLVVFVAGFNVFFTLLVILISYFFICITIQRMHSAEGQKKVFSTCAS
HLTALSIFYGTIIFMYLQPNSSQSVDTDKIASVFYTVVIPMLNPLIYSLRNKEVKSALWK
ILNKLYPQY

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS T/C Y/C 1000GP (YRI, YRI, YRI)
11 58,274,764 58,274,764 NS G/T S/Y rs58454093 (DbSNP)
11 58,507,182 58,507,182 SYN T/C Q/Q 1000GP (CEU)
11 58,507,314 58,507,314 SYN G/A S/S 1000GP (CEU)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 231 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

Y309C I279F S272Y % Freq CORP
1 Y I S 92.01 0.180
2 Y F S 5.80 0.180
3 Y I Y 1.53 0.180
4 C I S 0.66 0.180

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5B21.aApr07-unspliced main_exon 3UTR chr11 58,507,176 58,507,179 -
CDS chr11 58,507,179 58,508,105 -