Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5B3 Olfactory Receptor

Gene Symbol OR5B31 (View this gene in GeneCards)
Family 5
Subfamily B
Pseudogene No
CORP pseudogene probability score 0.04 (functional)
Aliases OST129, OR11-239, HsOR11.12.20, ORL3811
External Ids HGNC: 8324   GeneBank: AB065545, BK004506, NM_001005469   ORDB: ORL3811   
Build #39 labels OR5B3, OR5B13
Chromosomal location 11:58,402,468-58,403,409 (-)
Cluster 11@58
Synteny CLIC#27
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5B12 74.36% 312
OR5B1P 80.65% 310
OR5B2 77.2% 307

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5B3 81% 311
Dog OR5B2B 80% 313
Dog OR5B3B 81% 311
Chimp CONTIG229.261-6027 80% 310
Mouse Or5b3 81% 307
Rat Or5b3 79% 301
Cow OR5B140 75% 313

Expression evidences

Source Accession
ESTs BU101706

Sequence information

Nucleotide sequence ATGGAAAATAAGACAGAAGTAACACAATTCATTCTTCTAGGACTAACCAATGACTCAGAA
CTGCAGGTTCCCCTCTTTATAACGTTCCCCTTCATCTATATTATCACTCTGGTTGGAAAC
CTGGGAATTATTGTATTGATATTCTGGGATTCCTGTCTCCACAATCCCATGTACTTTTTT
CTCAGTAACTTGTCTCTAGTGGACTTTTGCTACTCTTCAGCTGTCACTCCCATCGTCATG
GCTGGATTCCTTATAGAAGACAAGGTCATCTCTTACAATGCATGTGCTGCTCAAATGTAT
ATCTTTGTAGCTTTTGCCACTGTGGAAAATTACCTCTTGGCCTCAATGGCCTATGACCGC
TATGCAGCAGTGTGCAAACCCCTACATTACACCACAACCATGACAACAACTGTGTGTGCT
CGTCTGGCCATAGGCTCCTACCTCTGTGGTTTCCTGAATGCCTCCATCCACACTGGGGAC
ACATTTAGTCTCTCTTTCTGTAAGTCCAATGAAGTCCATCACTTTTTCTGTGATATTCCA
GCAGTCATGGTTCTCTCTTGCTCTGATAGACATATTAGCGAGCTTGTTCTTATTTATGTT
GTGAGCTTCAATATCTTTATAGCTCTCCTGGTTATCTTGATATCCTACACATTCATTTTT
ATCACCATCCTAAAGATGCACTCAGCTTCAGTATACCAGAAGCCTTTGTCCACCTGTGCC
TCTCATTTCATTGCAGTCGGCATCTTCTATGGGACTATTATCTTCATGTACTTACAACCC
AGCTCCAGTCACTCCATGGACACAGACAAAATGGCACCTGTGTTCTATACAATGGTCATC
CCCATGCTGAACCCTCTGGTCTATAGTCTGAGGAACAAGGAAGTGAAGAGTGCATTCAAG
AAAGTTGTTGAGAAGGCAAAATTGTCTGTAGGATGGTCAGTT
Conceptual translation MENKTEVTQFILLGLTNDSELQVPLFITFPFIYIITLVGNLGIIVLIFWDSCLHNPMYFF
LSNLSLVDFCYSSAVTPIVMAGFLIEDKVISYNACAAQMYIFVAFATVENYLLASMAYDR
YAAVCKPLHYTTTMTTTVCARLAIGSYLCGFLNASIHTGDTFSLSFCKSNEVHHFFCDIP
AVMVLSCSDRHISELVLIYVVSFNIFIALLVILISYTFIFITILKMHSASVYQKPLSTCA
SHFIAVGIFYGTIIFMYLQPSSSHSMDTDKMAPVFYTMVIPMLNPLVYSLRNKEVKSAFK
KVVEKAKLSVGWSV

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS T/C K/R 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN C/G L/L 1000GP (YRI, YRI, YRI, YRI, YRI)
11 58,169,996 58,169,996 NS C/T R/K rs12279895 (DbSNP)
11 58,170,025 58,170,025 SYN C/G L/L rs12271646 (DbSNP)
11 58,170,106 58,170,106 SYN C/T Q/Q rs12279957 (DbSNP)
11 58,170,143 58,170,143 NS C/G G/A rs11229409 (DbSNP)
11 58,170,291 58,170,291 NS C/T V/I rs11229410 (DbSNP)
11 58,170,342 58,170,342 NS C/T A/T rs11229411 (DbSNP)
11 58,170,374 58,170,374 NS C/T S/N rs12280114 (DbSNP)
11 58,170,462 58,170,462 NS A/G C/R rs12284790 (DbSNP)
11 58,170,469 58,170,469 SYN A/C V/V rs11229412 (DbSNP)
11 58,170,738 58,170,738 NS A/G W/R rs11229413 (DbSNP)
11 58,170,780 58,170,780 NS A/T F/I rs17152659 (DbSNP)
11 58,170,794 58,170,794 NS A/G L/P rs17152661 (DbSNP)
11 58,402,523 58,402,523 NS T/C K/R 1000GP (CEU, CHBJPT)
11 58,402,552 58,402,552 SYN C/G L/L 1000GP (CEU, CHBJPT)
11 58,402,670 58,402,670 NS C/G G/A 1000GP (CEU, CHBJPT)
11 58,402,818 58,402,818 NS T/C I/V 1000GP (CEU, CHBJPT)
11 58,402,869 58,402,869 NS C/T A/T 1000GP (CEU, CHBJPT)
11 58,402,901 58,402,901 NS T/C N/S 1000GP (CEU, CHBJPT)
11 58,402,996 58,402,996 SYN C/A V/V 1000GP (CEU, CHBJPT)
11 58,403,265 58,403,265 NS A/G W/R 1000GP (CEU, CHBJPT)
11 58,403,307 58,403,307 NS T/A I/F 1000GP (CHBJPT)
11 58,403,321 58,403,321 NS G/A P/L 1000GP (CEU)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 174 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

K296R M266T G247A I198V A181T N170S T158I R141H R141C M57I W49R I35F P30L % Freq CORP
1 K M G I A N T R R M W I P 64.36 0.109
2 R M A V T S T R R M R I P 28.19 0.109
3 K M G I A N T R R M W F P 3.23 0.109
4 R T A V T S T R R M R I P 1.15 0.109
5 K M G I A N T R R M W I L 1.00 0.109
6 R M A V T S T R C M R I P 0.77 0.109
7 K M G I A N T H R M W I P 0.46 0.109
8 K M A V T S T R C M R I P 0.23 0.109
9 K M G I A N T R R I W I P 0.23 0.505
10 R M G V T S T R R M R I P 0.08 0.109
11 R M A V T S T R R M R I L 0.08 0.109
12 R M A V T S T R R M W I P 0.08 0.109
13 K M G I A S T R R M W I P 0.08 0.109
14 K M G I A N I R R M W I P 0.08 0.109

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5B3.aApr07-unspliced main_exon 3UTR chr11 58,402,465 58,402,468 -
CDS chr11 58,402,468 58,403,409 -