Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5BE1P Olfactory Receptor

Gene Symbol OR5BE1P1 (View this gene in GeneCards)
Family 5
Subfamily BE
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-166, HsOR11.11.44P, ORL3578
External Ids HGNC: 15273   GeneBank: AF399352, BK004693, NG_004201   ORDB: ORL3578   
Build #39 labels OR5BE1P
Chromosomal location 11:56,082,801-56,083,736 (+)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5F2P 45.66% 311
OR5J1P 49.2% 311
OR5J2 48.7% 308

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5BE4 76% 312
Mouse Or5be3 74% 312
Rat Or5be3 75% 312
Cow OR5BE5 77% 312
Orang OR5E1P 45% 311
Horse OR5BE1 81% 274
Chimp OR5J1 51% 312

Sequence information

Nucleotide sequence ATGGCTGACAGAAATGTCACTGTGATAACTGAATTCATCCTCCTGGGGTTGACTGATAAC
CCTGAAATGAATGTTGTCCTTTCTGTGCTCTTTCTATTAATCTATCTCATTACTGTCTTG
GGCAACTTTTGGATTATCATAATAATTCTGGCTAGTGCCCAACTCCATTCACCCATGTAC
TTTTTCCTTAGCCAGTTGGCTTTCTTAGATTTCTGCTATTCTTCAGTCTTGATTCCTAAA
ATGTTGGTGAATTACATAGCAGGACAGAAAGTCATCTCTTATCACGGTTGCCTCCTTCAG
TATTCCTTTGTCAGCTTGTTCCTGACTACTGAATGCTTCCTCCTGGCTGCCATGGCATGT
GATCGGTATCTCGCTGTTTGCCACCCACTTCACTACAAAGGTCTCATGACTCCTACTTTC
TGAATCTATTTGGTGACTGTTTCTTACCTGCTGGGCTCTGTAAACTCCCTCACCCACCTG
AGTAGCTTACTCAGTTTGTCTTTCTGTGGGTCCAATGTTATCAACCGTTATTTCTGTGAC
ATTCCATTGCTCTTCCAACTCTCCTGTTCCAACACCCAACACAGTAAGATTTTATTTACT
GTCCTTTCTGGAGCAACATCAGTGACTACCTTTTTGATAGTGGTTAGTTCCTATCTGGTA
ATCCTACTCATTGTCCTGAAGATACATTCCACCAGGGGCAGAAATAAAGCCATATCCACA
TGTGCCTCCCACCTAATGGTAGTGACTCTCTTCTACAGAACAGTGATATTTACTTATCTG
GGAGCCAACCCTGGATACTCACAGGATAGACCCAAAATTCTGCCTGTGGAGTGCACACTT
TTGTTGTCAATACTAAATCTTCTAATATATAGCGTGAGAAACAGAGAAGTCAAAGAAGCC
ATAAAAATAATTATTAAGAGAAAAATACTTCCTCAG
Conceptual translation MADRNVTVITEFILLGLTDNPEMNVVLSVLFLLIYLITVLGNFWIIIIILASAQLHSPMY
FFLSQLAFLDFCYSSVLIPKMLVNYIAGQKVISYHGCLLQYSFVSLFLTTECFLLAAMAC
DRYLAVCHPLHYKGLMTPTFXYLVTVSYLLGSVNSLTHLSSLLSLSFCGSNVINRYFCD
IPLLFQLSCSNTQHSKILFTVLSGATSVTTFLIVVSSYLVILLIVLKIHSTRGRNKAIST
CASHLMVVTLFYRTVIFTYLGANPGYSQDRPKILPVECTLLLSILNLLIYSVRNREVKEA
IKIIIKRKILPQ

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP C/T 1000GP (YRI, YRI, YRI, YRI)
11 55,850,448 55,850,448 SNP C/T rs61887074 (DbSNP)
11 55,850,531 55,850,531 SNP C/T rs7118155 (DbSNP)
11 55,850,561 55,850,561 SNP C/T rs61734131 (DbSNP)
11 55,850,947 55,850,947 SNP C/T rs1384090 (DbSNP)
11 55,851,022 55,851,022 SNP A/C rs17530318 (DbSNP)
11 55,851,124 55,851,124 SNP C/T rs17530360 (DbSNP)
11 56,082,972 56,082,972 SNP C/T 1000GP (CEU)
11 56,083,000 56,083,000 SNP C/T 1000GP (CEU)
11 56,083,055 56,083,055 SNP C/T 1000GP (CEU, CHBJPT)
11 56,083,165 56,083,165 SNP G/A 1000GP (CHBJPT)
11 56,083,471 56,083,471 SNP T/C 1000GP (CEU, CHBJPT)
11 56,083,546 56,083,546 SNP C/A 1000GP (CEU)
11 56,083,648 56,083,648 SNP C/T 1000GP (CEU)
11 56,083,691 56,083,691 SNP C/A 1000GP (CHBJPT)

Variations - CNVs

Chr Start End Type Sources
11 54,835,623 55,879,426 CopyNumber Variation_8690 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.