Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5BM1P Olfactory Receptor

Gene Symbol OR5BM1P1 (View this gene in GeneCards)
Family 5
Subfamily BM
Pseudogene Yes
CORP pseudogene probability score
Aliases ORL3106
External Ids HGNC: 14835   GeneBank: NG_004145   ORDB: ORL3106   
Build #39 labels OR5BM1P
Chromosomal location 3:98,052,893-98,053,818 (+)
Cluster 3@98
Synteny CLIC#9
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5AC1P 55.15% 136
OR5AC2 52.21% 136
OR5AC4P 55.88% 136

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5AC27 64% 143
Mouse Or5ac20 47% 179
Rat Or5ac20-ps 47% 179
Cow OR5AC29P 61% 143
Orang OR5CO1P 88% 109
Horse OR5AC35P 54% 141
Chimp OR5CO1P 96% 113

Sequence information

Nucleotide sequence GTTAGTCATTGCCTATTAATTTGGTTAATCCTTTCTCCCCATTTAATTTGTTATTTAAAT
AAAATTTATAATTTACTATTTAACTTATCACTTAAATTGAATCCAGATATTCAAAACACT
GGCCATTCTTTCTACTATGATGTTTTTGTAATGTTTTATTCCACCTTGACTGTGATAGTC
CCGTTTGTAATACCAAGAGGATCAGATCATTTTTTGTTCTAGAAAGATAAAAAAGTTCCT
GAAAGAATGAGAAAATACACTTTTGAACCCAAAACAAAGTCTCATTTTCTAAGATTTTGG
CATAAAATATACCGTGTACCTTTTGCTCTTAAAACACTTCGTTGTTAATACATTCAATTT
TAAGGTACTTATGAGTGGCAGGCTATGGGACTAGTTAGTTCTTGTCTAGAATCTCCTCTA
TAACCCTCAAGAAATAATATGTATTTTAAAAAAATCTTACCATTTTTTCAGTGTACAATA
TACAATTTCTTACATTGATCCATTTATTAACTCATTAGTGATTTTGTGGTTTTCACTGCT
TTTATACAAGCTTTTGCTTTTATGATCATCATAGTTTCTTATACCCAAGTCCTCTTTGCC
TTACTGAAAAAGAATTCTGAGAAGGGCAGAAGCAAAAGCTTCCTCATGTGCAGTGCCCAC
CTGCTCTCTGTCTCTTTGTTCTATAGCAGTGTCTTCTTCATGTATGGGTGCCCCAGGTCT
GGCCCAGATTAACAGTGGAATGAAATGTATTTTCCGTTCTACATGATTATAATTCCTCTG
CAGACTCCTTTATTTACAGTATGAAAAACAAAGAAGTTTTAGGTACACTTAGAACAATGA
TAAAGAAATATTTTTGGAGAACACTTTCATAATTCTTTCCATTTCCTTTCTGTTAAAACA
AATCGTAATAATTGTTTCTGTGTTTT
Conceptual translation VSHCLLIWLILSPHL\VIXKFIIYYLTYHLNXQIFKTLAILSTMMFLXFIPPXX
SRLXQEDQIIFCSRKIKKFLKEXNTLLNPKQSLIFXFGIKYTVYLLLLKHFVVNTFN
FKVLMSGRXMGLVSSCLESPLXSRNNMYFKKILPFFQCT\TISYIDPFINSLV/FV
VFTAFIQAFAFMIIIVSYTQVLFALLKKNSEKGRSKSFLMCSAHLLSVSLFYSSVFFMYG
CPRSGPDXWNEMYFPFYMIIIPLQTP/IYSMKNKEVLGTLRTMIKKYFWRTLSXFPF
PFCXKSXLFLCF

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
3 100 -100 SNP T/C 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
3 97,771,810 97,771,810 Del(1) -/T rs34309959 (DbSNP)
3 97,771,827 97,771,827 SNP T/C rs844259 (DbSNP)
3 97,771,983 97,771,983 SNP G/A rs832096 (DbSNP)
3 97,772,007 97,772,007 SNP G/A rs832095 (DbSNP)
3 97,772,071 97,772,071 SNP C/T rs6789767 (DbSNP)
3 97,772,072 97,772,072 SNP A/C rs6802201 (DbSNP)
3 97,772,184 97,772,184 SNP A/T rs56083722 (DbSNP)
3 97,772,231 97,772,231 SNP C/T rs72918461 (DbSNP)
3 97,772,622 97,772,622 SNP C/T rs12497216 (DbSNP)
3 97,772,624 97,772,624 SNP C/T rs9826748 (DbSNP)
3 97,772,635 97,772,635 SNP C/T rs9878663 (DbSNP)
3 98,052,983 98,052,983 SNP C/T 1000GP (CEU, CHBJPT)
3 98,053,139 98,053,139 SNP A/G 1000GP (CEU, CHBJPT)
3 98,053,163 98,053,163 SNP A/G 1000GP (CEU, CHBJPT)
3 98,053,340 98,053,340 SNP A/T 1000GP (CEU, CHBJPT)
3 98,053,778 98,053,778 SNP C/T 1000GP (CEU)
3 98,053,780 98,053,780 SNP T/C 1000GP (CEU, CHBJPT)
3 98,053,791 98,053,791 SNP C/T 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
3 97,746,851 97,778,744 CopyNumber Variation_30179 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.