Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5BN1P Olfactory Receptor

Gene Symbol OR5BN1P1 (View this gene in GeneCards)
Family 5
Subfamily BN
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-161, ORL3579
External Ids HGNC: 15276   GeneBank: BK004605, NG_004199   ORDB: ORL3579   
Build #39 labels OR5BN1P
Chromosomal location 11:56,132,666-56,133,494 (-)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR8U1 63.16% 154

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR8U9 66% 114
Chimp CONTIG970.12-4732 94% 277
Mouse Or8u8 69% 62
Rat Or8u9 69% 61
Cow OR8U9 63% 114

Sequence information

Nucleotide sequence GGAAACATTTTTACATTTATCCACATAGGTGTCTTAATTTTCCTAAAGAAACATCCCCAC
TCTCCAGAGGTGCCAAATAAATATTTATTGAAATCCATGTCATGATGAATTTTCTGCCTG
CCAAAAATAATCATTACTTTATTGCAGTAGGAGTGGGATGCTTTAAATTTAGAGACACGG
GTTTTTCTGGAAGAGGACTTCCCATGTGGATTCAGCTTGTGGATTGTACGTCAATTGTCT
TTTTTCTTGGAAATAAATTAATTTGCTCATTTAAAAAAATGATGCAGGAAGCATACGAGT
ACTTTTTCTCTGAGCAACTTGGCTTTTTAAGTTTCTGTTATGCTTCAGTCATTACATCCA
AAATGTTTGGAAGTTTCTTGTACAAACAAAAAAAATTAACCTTCAATGCACATAGGCTGC
TCTCTCACCTTCATGACCACCGAGTGCTTGCTCTAGCTTTCATGGCCTGTGATCAATACC
TGGTCATTTGTAATCCTCCTTTGTATATGGTCACCATGTCCCCCCCGCAAGGAGTCTGCA
TTCAGCTTATGCCTGCCTCCTATAGCTATAGCTTCCTGATGACACTTTCACATTATCCTC
AGCCTTTGTCTCCCTTATTGCCCCTCTGTATCATTGATGTTCAATGGAAGCCTGTTCCTT
ATGTACTTAATGCTCAGAAAATTCTCTTGACACAGACAGGATGGCCTCTGTCTTCTACAC
AGTAGTCATTCCCATGTTGAGCCCTTTGATCTGGAGCCTCAGGAACAAGGATGTGAAAGA
TGCCCTGAGGAAAGTCATTGTCAACAGAAACCAGGCATTATTTTGTTCA
Conceptual translation GNIFTFIHIGVLIFLKKHPHSPEVPNKYLLKSXVMMNFLPAKNNHYFIAVGVGCFKFRD
TGFSGRGLPMWIQLVDCTSIVFFLGNKLICSFKKMMQEAYEYFFS\NLAFXDFCYASV
ITSKMFGSFLYKQKKLTFNA\GCSLTFMTTECL/LAFMACDQYLVICNPPLYMVTMSP
PQGVCIQLMPASYSYSFLMTLSHY/SAF/LPYCPSVSLMFNGSLFLMYLM\ENSLDT
DRMASVFYTVVIPMLSPLIWSLRNKDVKDALRKVIVNRNQALFCS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP C/T 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
11 55,900,230 55,900,230 SNP C/T rs2460203 (DbSNP)
11 55,900,444 55,900,444 SNP C/G rs2512790 (DbSNP)
11 55,900,447 55,900,447 SNP A/G rs7124196 (DbSNP)
11 55,900,452 55,900,451 Ins(1) -/G rs61131111 (DbSNP)
11 55,900,462 55,900,462 SNP C/T rs7125117 (DbSNP)
11 55,900,463 55,900,463 SNP A/C rs7110376 (DbSNP)
11 55,900,477 55,900,477 SNP A/G rs1482000 (DbSNP)
11 55,900,721 55,900,721 SNP C/T rs1482001 (DbSNP)
11 55,900,913 55,900,912 Ins(1) -/G rs35239260 (DbSNP)
11 56,132,754 56,132,754 SNP C/T 1000GP (CEU, CHBJPT)
11 56,132,968 56,132,968 SNP C/G 1000GP (CEU)
11 56,132,971 56,132,971 SNP G/A 1000GP (CEU)
11 56,132,986 56,132,986 SNP C/T 1000GP (CEU)
11 56,132,987 56,132,987 SNP A/C 1000GP (CEU)
11 56,133,001 56,133,001 SNP A/G 1000GP (CEU, CHBJPT)
11 56,133,245 56,133,245 SNP C/T 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 171 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.