Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5BP1P Olfactory Receptor

Gene Symbol OR5BP1P1 (View this gene in GeneCards)
Family 5
Subfamily BP
Pseudogene Yes
CORP pseudogene probability score
Aliases ORL3520
External Ids HGNC: 15277   GeneBank: NG_004198   ORDB: ORL3520   
Build #39 labels OR5BP1P
Chromosomal location 11:57,055,700-57,056,133 (+)
Cluster 11@57
Synteny CLIC#26
Remarks Disrupted by MIR repeat

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5AK3P 42.11% 133

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Chimp CONTIG229.102-393 87% 182
Cow OR5AK7 43% 133

Sequence information

Nucleotide sequence CTAGGTATAATTTAATTTACATAGTGAAACAAGCCATTCTTAGGTATATTCCTTAGTTCT
GTCTTCGAAAGTCTGCATCCTGTTAGCAGCTGGCGTAGTTGGTGGGATACTTAGCAGAAG
GATTGTATGTGTGTCCTACTGTTTCACTGTCCTCCTCCAGGTCCAATGCCATCAATCACT
TTTTCTGTAATAAATCCCTAGGGCTTGGTCTTTCATGCTACAACATTTATATCAGCACAG
CAGTCCCTGCCTTTGCAGAGTTTGAGTGCTGCATTCATTGCCATATTTGGTCATCATGTT
CTCCTGGACATATATCCTGGTTGCTATCAAGAGGATGTCCTCAGTGGGGAGAAAAGAATT
GTCTATTTGTGTCTCCCACCTGAAAACTAGCACCATTTTTCATACAGCCCTCTTTTATGT
GTACTTACAGCCTG
Conceptual translation FLVKVKKNXIFLSTAYHFFPTLSVNNNKFLXINNNFXXNLHSETSHSXYSLVLSS
KVCILLA\AXVGYLAEGLYVCPTVSLSSSRSNAINHFFCNKSLGLGLSCYNIYISTAV
PAFAEFE/LHSLPYLVIMFSWTYILVAIKRMSSVGRKELSICVSHLKTSTIFHTALFYV
YLQP

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP A/G 1000GP (YRI)
11 56,823,213 56,823,212 Ins(1) -/G rs35583619 (DbSNP)
11 56,823,250 56,823,250 SNP C/T rs17151564 (DbSNP)
11 56,823,431 56,823,431 SNP A/G rs496761 (DbSNP)
11 57,055,775 57,055,775 SNP C/T 1000GP (CEU, CHBJPT)
11 57,055,956 57,055,956 SNP A/G 1000GP (CEU, CHBJPT)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.