Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5D14 Olfactory Receptor

Gene Symbol OR5D141 (View this gene in GeneCards)
Family 5
Subfamily D
Pseudogene No
CORP pseudogene probability score 0.26 (functional)
Aliases OR11-150, OR11-141, HsOR11.11.27, ORL3426
External Ids HGNC: 15281   GeneBank: AB065779, AF399523, BK004328, BK004393, NM_001004735   ORDB: ORL3426   
Build #39 labels OR5D14
Chromosomal location 11:55,795,556-55,796,497 (+)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5D16 68.47% 314
OR5D18 71.06% 311
OR5D3P 64.63% 311

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5D14 87% 314
Chimp CONTIG970.45-5046 99% 279
Mouse Or5d14 83% 309
Rat Or5d36 78% 308
Cow OR5D14 88% 312

Expression evidences

Source Accession
mRNA AB463969

Sequence information

Nucleotide sequence ATGATGATGGTTTTAAGGAATCTGAGCATGGAGCCCACCTTTGCCCTTTTAGGTTTCACA
GATTACCCAAAGCTTCAGATTCCTCTCTTCCTTGTGTTTCTGCTCATGTATGTTATCACA
GTGGTAGGAAACCTTGGGATGATCATAATAATCAAGATTAACCCCAAATTTCACACTCCT
ATGTACTTTTTCCTTAGTCACCTCTCTTTTGTTGATTTTTGTTACTCTTCCATTGTCACT
CCCAAGCTGCTTGAGAACTTGGTAATGGCAGATAAAAGCATCTTCTACTTTAGCTGCATG
ATGCAGTACTTCCTGTCCTGCACTGCTGTGGTGACAGAGTCTTTCTTGCTGGCAGTGATG
GCCTATGACCGCTTTGTGGCCATCTGCAATCCTCTGCTTTATACAGTGGCCATGTCACAG
AGGCTCTGTGCCCTGCTGGTGGCTGGGTCATATCTCTGGGGCATGTTTGGCCCCTTGGTA
CTCCTTTGTTATGCTCTCCGGTTAAACTTCTCTGGACCTAATGTAATCAACCACTTCTTT
TGTGAGTATACTGCTCTCATCTCTGTGTCTGGCTCTGATATACTCATCCCCCACCTGCTG
CTTTTCAGCTTCGCCACCTTCAATGAGATGTGTACACTACTGATCATCCTCACTTCCTAT
GTTTTCATTTTTGTGACTGTACTAAAAATCCGTTCTGTTAGTGGGCGCCACAAAGCCTTC
TCCACCTGGGCCTCCCACCTGACTTCTATCACCATCTTCCATGGGACCATCCTTTTCCTT
TACTGTGTACCCAACTCCAAAAACTCTCGGCAAACAGTCAAAGTGGCCTCTGTATTTTAC
ACAGTTGTCAACCCCATGCTGAACCCTCTGATCTACAGCCTAAGGAATAAAGACGTGAAG
GATGCTTTCTGGAAGTTAATACATACACAAGTTCCATTTCAC
Conceptual translation MMMVLRNLSMEPTFALLGFTDYPKLQIPLFLVFLLMYVITVVGNLGMIIIIKINPKFHTP
MYFFLSHLSFVDFCYSSIVTPKLLENLVMADKSIFYFSCMMQYFLSCTAVVTESFLLAVM
AYDRFVAICNPLLYTVAMSQRLCALLVAGSYLWGMFGPLVLLCYALRLNFSGPNVINHFF
CEYTALISVSGSDILIPHLLLFSFATFNEMCTLLIILTSYVFIFVTVLKIRSVSGRHKAF
STWASHLTSITIFHGTILFLYCVPNSKNSRQTVKVASVFYTVVNPMLNPLIYSLRNKDVK
DAFWKLIHTQVPFH

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 55,563,910 55,563,910 Del(1) -/C rs35371580 (DbSNP)
11 55,563,846 55,563,846 NS A/C K/T rs61896310 (DbSNP)
11 55,563,761 55,563,761 NS A/G T/A rs61896309 (DbSNP)
11 55,563,738 55,563,738 NS A/G H/R rs67863827 (DbSNP)
11 55,563,602 55,563,602 NS A/G S/G rs68042892 (DbSNP)
11 55,563,900 55,563,900 NS C/T P/L rs297055 (DbSNP)
11 55,563,128 55,563,128 NS G/T V/F rs12800529 (DbSNP)
11 55,563,144 55,563,144 NS G/T G/V rs12800541 (DbSNP)
11 55,563,126 55,563,126 NS G/T G/V rs12800526 (DbSNP)
11 55,563,776 55,563,776 NS G/T A/S rs297054 (DbSNP)
11 55,563,085 55,563,085 SYN G/T G/G rs12800499 (DbSNP)
11 55,796,300 55,796,300 NS T/G S/A 1000GP (CEU)
11 55,796,262 55,796,262 NS G/A R/H 1000GP (CEU, CHBJPT)
11 55,796,370 55,796,370 NS C/A T/K 1000GP (CEU)
11 55,795,860 55,795,860 NS A/T Q/L 1000GP (CEU, CHBJPT)
11 55,796,424 55,796,424 NS T/C L/P 1000GP (CEU, CHBJPT)
11 55,796,126 55,796,126 NS G/A G/S 1000GP (CEU, CHBJPT)
11 55,796,285 55,796,285 NS G/A A/T 1000GP (CEU)
11 100 -100 NS A/G M/V 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 55,153,930 55,816,828 CopyNumber Variation_0308 (DGV)
11 55,475,356 55,563,900 CopyNumber Variation_1244 (DGV)
11 55,446,295 55,618,623 CopyNumber Variation_2167 (DGV)
11 55,339,702 55,638,112 CopyNumber Variation_2926 (DGV)
11 55,222,420 55,621,884 CopyNumber Variation_3852 (DGV)
11 54,835,623 55,879,426 CopyNumber Variation_8690 (DGV)
11 55,445,294 55,620,699 CopyNumber Variation_9187 (DGV)
11 55,377,006 55,620,699 CopyNumber Variation_9188 (DGV)
11 55,422,586 55,596,313 CopyNumber Variation_10360 (DGV)
11 55,422,585 55,596,313 CopyNumber Variation_29911 (DGV)
11 55,463,782 55,584,109 CopyNumber Variation_48056 (DGV)
11 55,437,126 55,596,313 CopyNumber Variation_48840 (DGV)
11 55,442,368 55,596,313 CopyNumber Variation_48841 (DGV)
11 55,444,868 55,591,047 CopyNumber Variation_48842 (DGV)
11 55,444,868 55,596,313 CopyNumber Variation_48843 (DGV)
11 55,447,427 55,596,313 CopyNumber Variation_53429 (DGV)
11 55,422,345 55,603,590 CopyNumber Variation_65956 (DGV)
11 55,560,070 55,602,798 CopyNumber Variation_85785 (DGV)
11 55,562,932 55,565,973 Deletion #289 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

M2V F64V Q102L V111M G191S R236H W243C A244T S249A T272K L290P V299M % Freq CORP
1 M F Q V G R W A A T L V 47.16 0.429
2 M F Q V G R W A A T P V 22.04 0.429
3 M F L V G R W A A T L V 13.59 0.840
4 M F Q V S H W A A T L V 10.14 0.383
5 M F Q V G R W T A K L V 2.53 0.429
6 M F Q V G R W A S T L V 2.07 0.490
7 V F Q V G R W A S T L V 0.69 0.490
8 M F Q V S R C A A T L V 0.61 0.191
9 M F Q V S R W A A T L M 0.15 0.429
10 M F Q V G R W T A T P V 0.15 0.429
11 M F Q M G R W A A T L V 0.15 0.429
12 M F Q V G R W A A K L V 0.15 0.429
13 V F Q V G R W A A T L V 0.08 0.429
14 M F Q V S H W T A K L V 0.08 0.383
15 M F L V G H W A A T L V 0.08 0.813
16 M V L V G R W A A T L V 0.08 0.951
17 V F Q V G R W A A T P V 0.08 0.429
18 M F L V G R W A A T P V 0.08 0.840
19 M V Q V G R W A A T L V 0.08 0.737

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5D14.aApr07-unspliced main_exon CDS chr11 55,795,556 55,796,497 +
3UTR chr11 55,796,497 55,796,500 +