Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5D16 Olfactory Receptor

Gene Symbol OR5D161 (View this gene in GeneCards)
Family 5
Subfamily D
Pseudogene No
CORP pseudogene probability score 0.77 (pseudogene)
Aliases OR11-154, HsOR11.11.31, ORL3392
External Ids HGNC: 15283   GeneBank: AB065783, AF399524, BK004397, NM_001005496   ORDB: ORL3392   
Build #39 labels OR5D16
Chromosomal location 11:55,838,752-55,839,735 (+)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5D18 80.77% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5D18 81% 312
Chimp CONTIG970.41-9651 94% 328
Mouse Or5d16 82% 312
Rat Or5d16-ps 83% 312
Cow OR5D18 78% 312

Expression evidences

Source Accession
mRNA AB463970

Sequence information

Nucleotide sequence ATGTTTCTGACAGAGAGAAATACGACATCTGAGGCCACATTCACTCTCTTGGGCTTCTCA
GATTACCTGGAACTGCAAATTCCCCTCTTCTTTGTATTTCTGGCAGTCTACGGCTTCAGT
GTGGTAGGGAATCTTGGGATGATAGTGATCATCAAAATTAACCCAAAATTGCATACCCCC
ATGTATTTTTTCCTCAACCACCTCTCCTTTGTGGATTTCTGCTATTCCTCCATCATTGCT
CCCATGATGCTGGTGAACCTGGTTGTAGAAGATAGAACCATTTCATTCTCAGGATGTTTG
GTGCAATTCTTTTTCTTTTGCACCTTTGTAGTGACTGAATTAATTCTATTTGCGGTGATG
GCCTATGACCACTTTGTGGCCATTTGCAATCCTCTGCTCTACACAGTTGCCATCTCCCAG
AAACTCTGTGCCATGCTGGTGGTTGTATTGTATGCATGGGGAGTCGCATGTTCCCTGACA
CTCGCGTGCTCTGCTTTAAAGTTATCTTTTCATGGTTTCAACACAATCAATCATTTCTTC
TGTGAGTTATCCTCCCTGATATCACTCTCTTACCCTGACTCTTATCTCAGCCAGTTGCTT
CTTTTCACTGTTGCCACTTTTAATGAGATAAGCACACTACTCATCATTCTGACATCTTAT
GCATTCATCATTGTCACCACCTTGAAGATGCCTTCAGCCAGTGGGCACCGCAAAGTCTTC
TCCACCTGTGCCTCCCACCTGACTGCCATCACCATCTTCCATGGCACCATCCTCTTCCTC
TACTGTGTACCCAACTCCAAAAACTCCAGGCACACAGTCAAAGTGGCCTCTGTGTTTTAC
ACCGTGGTGATCCCCTTGTTGAATCCCCTGATCTACAGTCTGAGAAATAAAGATGTTAAG
GATGCAATCCGAAAAATAATCAATACAAAATATTTTCATATTAAACATAGGCATTGGTAT
CCATTTAATTTTGTTATTGAACAA
Conceptual translation MFLTERNTTSEATFTLLGFSDYLELQIPLFFVFLAVYGFSVVGNLGMIVIIKINPKLHTP
MYFFLNHLSFVDFCYSSIIAPMMLVNLVVEDRTISFSGCLVQFFFFCTFVVTELILFAVM
AYDHFVAICNPLLYTVAISQKLCAMLVVVLYAWGVACSLTLACSALKLSFHGFNTINHFF
CELSSLISLSYPDSYLSQLLLFTVATFNEISTLLIILTSYAFIIVTTLKMPSASGHRKVF
STCASHLTAITIFHGTILFLYCVPNSKNSRHTVKVASVFYTVVIPLLNPLIYSLRNKDVK
DAIRKIINTKYFHIKHRHWYPFNFVIEQ

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 55,606,693 55,606,693 NS A/G T/A rs6591700 (DbSNP)
11 55,607,207 55,607,207 NS A/G E/G rs11820541 (DbSNP)
11 55,607,203 55,607,203 NS A/T I/F rs62001004 (DbSNP)
11 55,606,472 55,606,472 NS C/T T/M rs62001008 (DbSNP)
11 55,607,057 55,607,057 NS C/T S/F rs61896326 (DbSNP)
11 55,607,097 55,607,097 SYN A/G L/L rs62001005 (DbSNP)
11 55,606,818 55,606,818 SYN C/T S/S rs11231253 (DbSNP)
11 55,606,302 55,606,302 SYN G/T L/L rs6591699 (DbSNP)
11 55,839,581 55,839,581 NS C/T S/F 1000GP (CEU)
11 55,838,826 55,838,826 SYN G/T L/L 1000GP (CEU, CHBJPT)
11 55,839,342 55,839,342 SYN C/T S/S 1000GP (CEU, CHBJPT)
11 55,839,217 55,839,217 NS G/A A/T 1000GP (CEU)
11 55,838,996 55,838,996 NS T/C M/T 1000GP (CEU)
11 100 -100 SYN G/T L/L 1000GP (YRI, YRI, YRI)
11 100 -100 NS G/A A/T 1000GP (YRI)

Variations - CNVs

Chr Start End Type Sources
11 55,153,930 55,816,828 CopyNumber Variation_0308 (DGV)
11 55,446,295 55,618,623 CopyNumber Variation_2167 (DGV)
11 55,339,702 55,638,112 CopyNumber Variation_2926 (DGV)
11 55,222,420 55,621,884 CopyNumber Variation_3852 (DGV)
11 54,835,623 55,879,426 CopyNumber Variation_8690 (DGV)
11 55,445,294 55,620,699 CopyNumber Variation_9187 (DGV)
11 55,377,006 55,620,699 CopyNumber Variation_9188 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

M82T A156T A162T S277F N296S E327G % Freq CORP
1 M A A S N E 79.42 0.896
2 M T A S N E 12.75 0.896
3 M A A F N E 4.38 0.896
4 T A A S N E 2.15 0.896
5 M A A S N G 0.77 0.896
6 M A A S S E 0.38 0.896
7 T A T S N E 0.08 0.896
8 M T A F N E 0.08 0.896

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5D16.aApr07-unspliced main_exon CDS chr11 55,838,752 55,839,735 +
3UTR chr11 55,839,735 55,839,738 +