Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5D17P Olfactory Receptor

Gene Symbol OR5D17P1 (View this gene in GeneCards)
Family 5
Subfamily D
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-147, OR11-132, HsOR11.11.24P, ORL3545
External Ids HGNC: 15284   GeneBank: BK004595, BK004761, NG_004194   ORDB: ORL3545   
Build #39 labels OR5D17P
Chromosomal location 11:55,754,977-55,755,954 (+)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5D15P 68.28% 309
OR5D2P 67.76% 304
OR5D3P 68.98% 303

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5D17 85% 312
Mouse Or5d20-ps 80% 309
Rat Or5d20 78% 309
Cow OR5D79 75% 310
Orang OR8D4 47% 305
Horse OR5D17 83% 307
Horse OR5D17B 80% 311
Horse OR5D17C 80% 310
Chimp OR5D17 96% 316

Sequence information

Nucleotide sequence TTCTGTCTCTCTCTCTTTTAGTGAAGGGCCTTGGTACCAGAAGAGAGAAACCAGAGCTCT
GTGACCACATTCATCCTGTTGGGTTTCTCAGAATATCCACACCTCCAGGCGCCCCTCTTC
CTGGTGTTCTCGACCACCTACACTGTCGCTCTGGTGGGAAACCTGGGCATAATTGTGGTT
GTAAGAATCAATCCTAAGCTCCATACCACCATGTACTTTTTCCTCAGTCATCTATCCTTT
TTGGATACTTGTTATTCCAATGTATTTACACCCAAACTGTTAGAGATTTTGGTTGTGGAA
GACAGAACTATCTCCTTCAAAGGATGCATGGTACAATTTTTCTTTGGTTGTGCATTTGTA
ATCACAGAAATGTTCATGTTAGCGGTGATGGCTTATGACTTGTTTATGGCTGTTTGTAAC
CCCCTGCTCTACACAGTGGCTATGTCTCCTAAGCTCTGTGCTCTCCTGGTAACTGGAACT
TACACATGGGGTGGACTCTGTTCCCTGACACTCACTTATTCTCTTTTGGTGTTATCCTAC
TGTGGATCTAACATCATAAATCACTTTGGCTGTGAGTACTCTGCCATTCTTTCTCTATCC
TGCTCTGATCCCTACTTCAACCAGATGGCGTGTTTAGTCATTTCTATATTCAGTGAAGCT
TGTAGCCTCCTGGCCATCCTTGCCTTCTATGTCTTCATAGTTGCCACTGTCATCAAGATG
CTTTCTACGGGTGGACCCCAAAAGGCCATCTCCACCTGTGCCTCCCACCTGACCACCGTC
TCCATTTTCCATGGGGTCATCCTGCTCCTTTACTGTGTGCCCAACTCCAAAAGCTCATGG
CTCCTGGTCAAAGTGGCTACTGTACTTTTTACAGTCATAATCCCTATGCTGAATCCCCTG
ATCTACAGCCTTAGGAACAAAGATGTAAAAGAGACCGTCAGGAAGTTGATAAACTCCCAA
TCACCTTTTCACTCAAAA
Conceptual translation FCLSLFXRALVPEERNQSSVTTFILLGFSEYPHLQAPLFLVFSTTYTVALVGNLGIIVV
VRINPKLHTTMYFFLSHLSFLDTCYSNVFTPKLLEILVVEDRTISFKGCMVQFFFGCAFV
ITEMFMLAVMAYDLFMAVCNPLLYTVAMSPKLCALLVTGTYTWGGLCSLTLTYSLLVLSY
CGSNIINHFGCEYSAILSLSCSDPYFNQMACLVISIFSEACSLLAILAFYVFIVATVIKM
LSTGGPQKAISTCASHLTTVSIFHGVILLLYCVPNSKSSWLLVKVATVLFTVIIPMLNPL
IYSLRNKDVKETVRKLINSQSPFHSK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP G/A 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 55,522,480 55,522,480 SNP A/G rs12785720 (DbSNP)
11 55,522,481 55,522,481 SNP A/C rs10897205 (DbSNP)
11 55,522,483 55,522,483 SNP A/T rs11827779 (DbSNP)
11 55,522,498 55,522,498 SNP A/G rs12790205 (DbSNP)
11 55,522,527 55,522,527 SNP C/T rs11826346 (DbSNP)
11 55,522,549 55,522,549 SNP C/T rs11230864 (DbSNP)
11 55,522,572 55,522,572 SNP C/T rs61744680 (DbSNP)
11 55,522,583 55,522,583 SNP C/T rs382150 (DbSNP)
11 55,522,664 55,522,664 SNP G/T rs11827814 (DbSNP)
11 55,522,666 55,522,666 SNP C/T rs61739480 (DbSNP)
11 55,522,729 55,522,729 SNP C/T rs393009 (DbSNP)
11 55,522,732 55,522,732 SNP C/T rs61740656 (DbSNP)
11 55,522,739 55,522,739 SNP C/T rs61740659 (DbSNP)
11 55,522,780 55,522,780 SNP A/T rs61743273 (DbSNP)
11 55,522,798 55,522,798 SNP G/T rs61743283 (DbSNP)
11 55,522,924 55,522,924 SNP G/A rs443028 (DbSNP)
11 55,522,959 55,522,959 SNP A/G rs35731916 (DbSNP)
11 55,522,968 55,522,968 SNP A/T rs61746665 (DbSNP)
11 55,522,979 55,522,979 SNP C/T rs61746670 (DbSNP)
11 55,523,047 55,523,047 SNP C/G rs61740597 (DbSNP)
11 55,523,072 55,523,072 SNP A/G rs61740598 (DbSNP)
11 55,523,082 55,523,082 SNP A/G rs61740601 (DbSNP)
11 55,523,138 55,523,138 SNP C/T rs61743263 (DbSNP)
11 55,523,174 55,523,174 SNP C/T rs61743277 (DbSNP)
11 55,523,181 55,523,181 SNP A/G rs61743281 (DbSNP)
11 55,523,230 55,523,230 SNP A/G rs61745714 (DbSNP)
11 55,523,384 55,523,384 SNP A/G rs438025 (DbSNP)
11 55,523,397 55,523,397 SNP C/G rs67874622 (DbSNP)
11 55,523,410 55,523,410 SNP C/T rs67491981 (DbSNP)
11 55,755,004 55,755,004 SNP G/A 1000GP (CEU, CHBJPT)
11 55,755,005 55,755,005 SNP C/A 1000GP (CEU, CHBJPT)
11 55,755,007 55,755,007 SNP T/A 1000GP (CEU, CHBJPT)
11 55,755,022 55,755,022 SNP A/G 1000GP (CEU, CHBJPT)
11 55,755,051 55,755,051 SNP C/T 1000GP (CEU, CHBJPT)
11 55,755,073 55,755,073 SNP C/T 1000GP (CEU, CHBJPT)
11 55,755,107 55,755,107 SNP C/T 1000GP (CEU, CHBJPT)
11 55,755,188 55,755,188 SNP T/G 1000GP (CEU, CHBJPT)
11 55,755,253 55,755,253 SNP C/T 1000GP (CEU, CHBJPT)
11 55,755,263 55,755,263 SNP T/C 1000GP (CEU, CHBJPT)
11 55,755,304 55,755,304 SNP A/T 1000GP (CEU, CHBJPT)
11 55,755,448 55,755,448 SNP A/G 1000GP (CEU, CHBJPT)
11 55,755,483 55,755,483 SNP G/A 1000GP (CEU, CHBJPT)
11 55,755,492 55,755,492 SNP T/A 1000GP (CEU, CHBJPT)
11 55,755,571 55,755,571 SNP C/G 1000GP (CEU, CHBJPT)
11 55,755,596 55,755,596 SNP A/G 1000GP (CEU, CHBJPT)
11 55,755,606 55,755,606 SNP G/A 1000GP (CEU, CHBJPT)
11 55,755,662 55,755,662 SNP T/C 1000GP (CEU, CHBJPT)
11 55,755,698 55,755,698 SNP T/C 1000GP (CEU, CHBJPT)
11 55,755,705 55,755,705 SNP G/A 1000GP (CEU, CHBJPT)
11 55,755,754 55,755,754 SNP G/A 1000GP (CEU, CHBJPT)
11 55,755,908 55,755,908 SNP A/G 1000GP (CEU)
11 55,755,921 55,755,921 SNP G/C 1000GP (CEU, CHBJPT)
11 55,755,934 55,755,934 SNP C/T 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
11 54,835,623 55,879,426 CopyNumber Variation_8690 (DGV)
11 55,153,930 55,816,828 CopyNumber Variation_0308 (DGV)
11 55,222,420 55,621,884 CopyNumber Variation_3852 (DGV)
11 55,339,702 55,638,112 CopyNumber Variation_2926 (DGV)
11 55,377,006 55,620,699 CopyNumber Variation_9188 (DGV)
11 55,382,681 55,548,038 CopyNumber Variation_4743 (DGV)
11 55,422,345 55,603,590 CopyNumber Variation_65956 (DGV)
11 55,422,585 55,596,313 CopyNumber Variation_29911 (DGV)
11 55,422,586 55,596,313 CopyNumber Variation_10360 (DGV)
11 55,437,126 55,596,313 CopyNumber Variation_48840 (DGV)
11 55,442,368 55,596,313 CopyNumber Variation_48841 (DGV)
11 55,444,868 55,591,047 CopyNumber Variation_48842 (DGV)
11 55,444,868 55,596,313 CopyNumber Variation_48843 (DGV)
11 55,445,294 55,620,699 CopyNumber Variation_9187 (DGV)
11 55,446,295 55,618,623 CopyNumber Variation_2167 (DGV)
11 55,447,427 55,596,313 CopyNumber Variation_53429 (DGV)
11 55,460,683 55,547,092 CopyNumber Variation_38236 (DGV)
11 55,463,782 55,584,109 CopyNumber Variation_48056 (DGV)
11 55,475,356 55,563,900 CopyNumber Variation_1244 (DGV)
11 55,521,157 55,522,913 CopyNumber Variation_85782 (DGV)
11 55,521,787 55,522,913 CopyNumber Variation_85783 (DGV)
11 55,522,353 55,525,430 Deletion #298 (Waszak)
11 55,523,241 55,526,896 CopyNumber Variation_75648 (DGV)
11 55,523,241 55,558,796 CopyNumber Variation_85784 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.