Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5D18 Olfactory Receptor

Gene Symbol OR5D181 (View this gene in GeneCards)
Family 5
Subfamily D
Pseudogene No
CORP pseudogene probability score
Aliases OR11-143, OR11-152, HsOR11.11.29, ORL3394, ORL3395
External Ids HGNC: 15285   GeneBank: AB065781, AF399525, BK004329, BK004395, NM_001001952   ORDB: ORL3394, ORL3395   
Build #39 labels OR5D18
Chromosomal location 11:55,819,630-55,820,568 (+)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5D16 80.77% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5D18 85% 313
Chimp CONTIG970.43-8660 98% 313
Mouse Or5d16 81% 313
Mouse Or5d18 82% 312
Rat Or5d16-ps 80% 313
Rat Or5d18 82% 312
Cow OR5D18 83% 313

Expression evidences

Source Accession
mRNA BC136925

Sequence information

Nucleotide sequence ATGCTGCTGACTGATAGAAATACAAGTGGGACCACGTTCACCCTCTTGGGCTTCTCAGAT
TACCCAGAACTGCAAGTCCCACTCTTCCTGGTTTTTCTGGCCATCTACAATGTCACTGTG
CTAGGGAATATTGGGTTGATTGTGATCATCAAAATCAACCCCAAACTGCATACCCCCATG
TACTTTTTCCTCAGCCAACTCTCCTTTGTGGATTTCTGCTATTCCTCCATCATTGCTCCC
AAGATGTTGGTGAACCTTGTTGTCAAAGACAGAACCATTTCATTTTTAGGATGCGTAGTA
CAATTCTTTTTCTTCTGTACCTTTGTGGTCACTGAATCCTTTTTATTAGCTGTGATGGCC
TATGACCGCTTCGTGGCCATTTGCAACCCTCTGCTCTACACAGTTAACATGTCCCAGAAA
CTCTGCGTGCTGCTGGTTGTGGGATCCTATGCCTGGGGAGTCTCATGTTCCTTGGAACTG
ACGTGCTCTGCTTTAAAGTTATGTTTTCATGGTTTCAACACAATCAATCACTTCTTCTGT
GAGTTCTCCTCACTACTCTCCCTTTCTTGCTCTGATACTTACATCAACCAGTGGCTGCTA
TTCTTTCTTGCCACCTTTAATGAAATCAGCACACTACTCATCGTTCTCACATCTTATGCG
TTCATTGTTGTAACCATCCTCAAGATGCGTTCAGTCAGTGGGCGCCGCAAAGCCTTCTCC
ACCTGTGCCTCCCACCTGACTGCCATCACCATCTTCCATGGCACCATCCTCTTCCTTTAC
TGTGTGCCCAACTCCAAAAACTCCAGGCACACAGTCAAAGTGGCCTCTGTGTTTTACACC
GTGGTGATCCCCATGTTGAATCCCCTGATCTACAGTCTGAGAAATAAAGATGTCAAGGAT
ACAGTCACCGAGATACTGGACACCAAAGTCTTCTCTTAC
Conceptual translation MLLTDRNTSGTTFTLLGFSDYPELQVPLFLVFLAIYNVTVLGNIGLIVIIKINPKLHTPM
YFFLSQLSFVDFCYSSIIAPKMLVNLVVKDRTISFLGCVVQFFFFCTFVVTESFLLAVMA
YDRFVAICNPLLYTVNMSQKLCVLLVVGSYAWGVSCSLELTCSALKLCFHGFNTINHFFC
EFSSLLSLSCSDTYINQWLLFFLATFNEISTLLIVLTSYAFIVVTILKMRSVSGRRKAFS
TCASHLTAITIFHGTILFLYCVPNSKNSRHTVKVASVFYTVVIPMLNPLIYSLRNKDVKD
TVTEILDTKVFSY

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 55,587,914 55,587,914 NS A/G H/R rs55832853 (DbSNP)
11 55,587,212 55,587,212 NS A/G Y/C rs7948629 (DbSNP)
11 55,587,457 55,587,457 NS A/G M/V rs11231180 (DbSNP)
11 55,587,827 55,587,827 NS C/T T/I rs55843616 (DbSNP)
11 55,587,587 55,587,587 NS C/T T/M rs62001009 (DbSNP)
11 55,587,511 55,587,511 NS G/A D/N rs297081 (DbSNP)
11 55,587,117 55,587,117 SYN A/T T/T rs297082 (DbSNP)
11 55,587,120 55,587,120 SYN C/T D/D rs62001011 (DbSNP)
11 55,819,736 55,819,736 NS A/G Y/C 1000GP (CEU)
11 55,820,035 55,820,035 NS A/G N/D 1000GP (CEU, CHBJPT)
11 55,819,728 55,819,728 SYN G/T L/L 1000GP (CEU)
11 55,820,438 55,820,438 NS A/G H/R 1000GP (CEU, CHBJPT)
11 55,819,641 55,819,641 SYN T/A T/T 1000GP (CEU)
11 55,819,981 55,819,981 NS G/A V/M 1000GP (CHBJPT)
11 100 -100 SYN T/A T/T 1000GP (YRI, YRI)
11 100 -100 NS A/G N/D 1000GP (YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 55,153,930 55,816,828 CopyNumber Variation_0308 (DGV)
11 55,446,295 55,618,623 CopyNumber Variation_2167 (DGV)
11 55,339,702 55,638,112 CopyNumber Variation_2926 (DGV)
11 55,222,420 55,621,884 CopyNumber Variation_3852 (DGV)
11 54,835,623 55,879,426 CopyNumber Variation_8690 (DGV)
11 55,445,294 55,620,699 CopyNumber Variation_9187 (DGV)
11 55,377,006 55,620,699 CopyNumber Variation_9188 (DGV)
11 55,422,586 55,596,313 CopyNumber Variation_10360 (DGV)
11 55,422,585 55,596,313 CopyNumber Variation_29911 (DGV)
11 55,437,126 55,596,313 CopyNumber Variation_48840 (DGV)
11 55,442,368 55,596,313 CopyNumber Variation_48841 (DGV)
11 55,444,868 55,591,047 CopyNumber Variation_48842 (DGV)
11 55,444,868 55,596,313 CopyNumber Variation_48843 (DGV)
11 55,447,427 55,596,313 CopyNumber Variation_53429 (DGV)
11 55,422,345 55,603,590 CopyNumber Variation_65956 (DGV)
11 55,560,070 55,602,798 CopyNumber Variation_85785 (DGV)
11 55,587,006 55,590,044 Deletion #291 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

Y36C V118M N136D T161M V215I R230S H270R % Freq CORP
1 Y V D T V R H 69.20 0.040
2 Y V D T V R R 24.96 0.040
3 C V D T V R H 2.69 0.126
4 Y M D T V R H 1.77 0.040
5 Y V D M V R H 0.38 0.040
6 Y V N T V R H 0.38 0.040
7 Y V D T I R R 0.38 0.040
8 C V D T V R R 0.15 0.126
9 Y V D T V S H 0.08 0.040

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5D18.aApr07-unspliced main_exon CDS chr11 55,819,630 55,820,568 +
3UTR chr11 55,820,568 55,820,571 +