Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5D2P Olfactory Receptor

Gene Symbol OR5D2P1 (View this gene in GeneCards)
Family 5
Subfamily D
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-7a, OR912-91, OR912-91, OR912-94, OR18-17, OR18-17, OR18-79, OR912-47, OR912-47, OR18-42, OR18-42, OR912-61, OR8-127, OR8-127, OR11-130, OR912-102, OR18-43, OR18-44, OR8-125, HsOR11.11.22P, ORL3482
External Ids HGNC: 8335   GeneBank: AF065858, AF399362, BK004703, NG_002277, U86246, U86247, U86287, U86288, U86296-U86298   ORDB: ORL3482   
Build #39 labels OR5D2P, OR5D10P, OR5D5P, OR5D12P, OR5D11P
Chromosomal location 11:55,714,781-55,715,718 (+)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5D3P 85.67% 314

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5D3 82% 286
Mouse Or5d3-ps 79% 310
Rat Or5d45-ps 73% 302
Cow OR5D3P 78% 311
Orang OR8D4 49% 306
Horse OR5D2 82% 316
Chimp OR5D3 86% 286

Sequence information

Nucleotide sequence TCCCTATTTTGTCCCAGGGACCAAGAAAATCAGACTTCTGAAGTCACCTTCATCCTCTTG
GGCTTCTCAGAATATCCAGACCTTCAGACGCCCCTGTTCCTGGTGTTCCTGACCATCTAC
ACAGTCACTGTGCTGGGGAATCTGGGCATGATCATAGTCATCAGGATCAGCCCCAAACTC
CACACCCCCATGTGCTTTTTCCTCAGCCACTTGTCCTTTGTTGATTTCTGTTATTCCACC
ACAATTACACCCAAACTGCTGGAGAACTTGGTTGTGGAAGATAGAACTATCTCCTTCACA
GGATGCACCATGCAGTTATTCTTTGTCTGCATATTTGTAGTAACAGAAACATTCATGCTG
GCAGTGATGGCCTATGACCGATATGTGGCGGTGTGTAACCCTCTTCTCTACACAGTTGCA
ATGTACCAGAGGCTTTGCTCCTTGTTAGTGGCTACATCATACTGTTGGGGGATAGTCTGT
TCCCTGACACTTACCTAGTTTCTACTGGAATTATCCTTCAGAGGAAATAATATCATTAAT
AACTTTGTCTGTGAGCACGCTGCCATTGTTGCTGTGTCTTGCTCTGACCCCTGTGTGAGC
CAGGAGATCACTTTAGTTTCTGCCACATTCAATGAAATAAGCAGCCTGCTTCCTATGCTT
TCATTTTTATCACTGTCATGAAGACGCCTTCCACTGGGGGGCGCAAGAAAGCGTTCTCCA
CGTCTGCCTCCCACTTGACGGCCATTACCATTTTCCATGGGACTATCCTTTTCCTCTACT
GTGTTCCTAACTCCAAAAGTTCGTGGCTCATGGTCAAGGTGGCCTCTGTCTTTTACACAG
TGGTCATTCCCATGCTGAACCCCTTGATCTATAGCCTCAGGAACAAAGATGTAAAAGAGA
CAGTTAGGAGGTTACTCATTACCAAATTATTATGTCTC
Conceptual translation SLFCPRDQENQTSEVTFILLGFSEYPDLQTPLFLVFLTIYTVTVLGNLGMIIVIRISPKL
HTPMCFFLSHLSFVDFCYSTTITPKLLENLVVEDRTISFTGCTMQLFFVCIFVVTETFML
AVMAYDRYVAVCNPLLYTVAMYQRLCSLLVATSYCWGIVCSLTLTXLLELSFRGNNIIN
NFVCEHAAIVAVSCSDPCVSQEITLVSATFNEISSL/SYAFIFITVMKTPSTGGRKKAF
STSASHLTAITIFHGTILFLYCVPNSKSSWLMVKVASVFYTVVIPMLNPLIYSLRNKDVK
ETVRRLLITKLLCL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 55,482,905 55,482,904 Ins(13) -/GTGATCATTCTCA rs71055527 (DbSNP)
11 55,482,906 55,482,905 Ins(13) -/GTGATCATTCTCA rs72176723 (DbSNP)
11 55,482,571 55,482,571 SNP A/G rs61742336 (DbSNP)
11 55,482,568 55,482,568 SNP A/G rs61742335 (DbSNP)
11 55,482,450 55,482,450 SNP A/G rs11821351 (DbSNP)
11 55,482,598 55,482,598 SNP A/G rs61742350 (DbSNP)
11 55,482,646 55,482,646 SNP A/G rs61744727 (DbSNP)
11 55,482,582 55,482,582 SNP C/T rs61742341 (DbSNP)
11 55,482,355 55,482,355 SNP C/T rs67966532 (DbSNP)
11 55,482,564 55,482,564 SNP C/T rs61742334 (DbSNP)
11 55,482,621 55,482,621 SNP C/T rs61742356 (DbSNP)
11 55,482,900 55,482,900 SNP G/T rs12222348 (DbSNP)
11 55,714,879 55,714,879 SNP C/T 1000GP (CEU, CHBJPT)
11 55,714,974 55,714,974 SNP G/A 1000GP (CEU, CHBJPT)
11 55,715,059 55,715,059 SNP A/C 1000GP (CEU)
11 55,715,088 55,715,088 SNP C/T 1000GP (CEU, CHBJPT)
11 55,715,480 55,715,480 SNP G/A 1000GP (CEU)
11 55,715,670 55,715,670 SNP T/C 1000GP (CEU)
11 100 -100 SNP C/T 1000GP (YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 55,153,930 55,816,828 CopyNumber Variation_0308 (DGV)
11 55,475,356 55,563,900 CopyNumber Variation_1244 (DGV)
11 55,446,295 55,618,623 CopyNumber Variation_2167 (DGV)
11 55,339,702 55,638,112 CopyNumber Variation_2926 (DGV)
11 55,222,420 55,621,884 CopyNumber Variation_3852 (DGV)
11 55,382,681 55,548,038 CopyNumber Variation_4743 (DGV)
11 54,835,623 55,879,426 CopyNumber Variation_8690 (DGV)
11 55,445,294 55,620,699 CopyNumber Variation_9187 (DGV)
11 55,377,006 55,620,699 CopyNumber Variation_9188 (DGV)
11 55,422,586 55,596,313 CopyNumber Variation_10360 (DGV)
11 55,422,585 55,596,313 CopyNumber Variation_29911 (DGV)
11 55,432,955 55,495,323 Inversion Variation_37124 (DGV)
11 55,460,683 55,547,092 CopyNumber Variation_38236 (DGV)
11 55,453,486 55,486,815 CopyNumber Variation_48052 (DGV)
11 55,437,126 55,483,713 CopyNumber Variation_48054 (DGV)
11 55,463,782 55,584,109 CopyNumber Variation_48056 (DGV)
11 55,437,126 55,596,313 CopyNumber Variation_48840 (DGV)
11 55,442,368 55,596,313 CopyNumber Variation_48841 (DGV)
11 55,444,868 55,591,047 CopyNumber Variation_48842 (DGV)
11 55,444,868 55,596,313 CopyNumber Variation_48843 (DGV)
11 55,447,427 55,596,313 CopyNumber Variation_53429 (DGV)
11 55,360,213 55,490,377 CopyNumber Variation_53507 (DGV)
11 55,422,345 55,603,590 CopyNumber Variation_65956 (DGV)
11 55,422,701 55,509,962 CopyNumber Variation_85778 (DGV)
CopyNumber 168 (Hasin)
11 55,482,157 55,485,194 Deletion #286 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.