Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5F1 Olfactory Receptor

Gene Symbol OR5F11 (View this gene in GeneCards)
Family 5
Subfamily F
Pseudogene No
CORP pseudogene probability score 0.06 (functional)
Aliases OR11-10, OR11-158, OR11-167, OR5F1, HsOR11.11.39, ORL3328
External Ids HGNC: 8343   GeneBank: AF065863, AF399527, BK004343, BK004722, NM_003697   ORDB: ORL3328   
Build #39 labels OR5F1
Chromosomal location 11:55,993,684-55,994,625 (-)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5F2P 91.08% 314

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5F2 84% 309
Mouse Or5w1b 55% 307
Rat Or5ap2 56% 304
Cow OR5F2C 83% 314
Cow OR5F2B 82% 314
Cow OR5F2 82% 314
Orang OR5E1P 54% 310
Horse OR5F11P 75% 302
Chimp OR5F2 92% 314

Expression evidences

Source Accession
mRNA BC101241
GNF Atlas2 gnf1h05456_at

Sequence information

Nucleotide sequence ATGACCAGAAAAAATTATACCTCACTGACTGAGTTCGTCCTATTGGGATTAGCAGACACG
CTGGAGCTACAGATTATCCTCTTTTTGTTTTTTCTTGTGATTTATACACTTACAGTACTG
GGAAATCTCGGGATGATCCTCTTAATCAGGATCGATTCCCAGCTTCACACACCCATGTAT
TTCTTCCTGGCTAACCTGTCCTTTGTGGACGTTTGTAACTCAACTACCATCACCCCAAAG
ATGCTGGCAGATTTATTATCAGAGAAGAAAACCATCTCTTTTGCTGGCTGCTTCCTACAG
ATGTACTTCTTTATCTCCCTGGCGACAACCGAATGCATCCTCTTTGGGTTAATGGCCTAT
GACAGGTATGCGGCCATATGTCGCCCGCTGCTTTACTCCTTGATCATGTCCAGGACCGTC
TACCTAAAAATGGCAGCCGGGGCTTTTGCTGCAGGGTTGCTGAACTTCATGGTCAACACA
AGCCATGTCAGCAGCTTGTCATTCTGTGACTCCAATGTCATCCATCACTTCTTCTGTGAC
AGTCCCCCACTTTTCAAGCTCTCTTGTTCTGACACAATCCTGAAAGAAAGCATAAGTTCT
ATTTTGGCTGGTGTGAATATTGTGGGGACTCTGCTTGTCATCCTCTCCTCCTACTCCTAC
GTTCTCTTCTCCATTTTTTCTATGCATTCGGGGGAGGGGAGGCACAGAGCTTTCTCCACG
TGTGCCTCTCACCTGACAGCCATAATTCTGTTCTATGCCACCTGCATCTATACTTACCTG
AGACCTAGTTCCAGCTACTCCCTGAATCAGGACAAAGTGGCTTCTGTGTTCTACACAGTG
GTGATTCCCATGTTGAATCCTCTGATCTACAGCCTCAGGAGTAAGGAAGTAAAGAAGGCT
TTAGCGAATGTAATTAGCAGGAAAAGGACCTCTTCCTTTCTG
Conceptual translation MTRKNYTSLTEFVLLGLADTLELQIILFLFFLVIYTLTVLGNLGMILLIRIDSQLHTPMY
FFLANLSFVDVCNSTTITPKMLADLLSEKKTISFAGCFLQMYFFISLATTECILFGLMAY
DRYAAICRPLLYSLIMSRTVYLKMAAGAFAAGLLNFMVNTSHVSSLSFCDSNVIHHFFCD
SPPLFKLSCSDTILKESISSILAGVNIVGTLLVILSSYSYVLFSIFSMHSGEGRHRAFST
CASHLTAIILFYATCIYTYLRPSSSYSLNQDKVASVFYTVVIPMLNPLIYSLRSKEVKKA
LANVISRKRTSSFL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS C/T S/N 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN A/G I/I 1000GP (YRI, YRI, YRI)
11 55,761,181 55,761,180 Ins(1) -/C rs34761514 (DbSNP)
11 55,761,221 55,761,221 NS T/C N/S rs2449134 (DbSNP)
11 55,761,251 55,761,251 NS A/G M/T rs66470326 (DbSNP)
11 55,761,270 55,761,270 NS A/G Y/H rs11825964 (DbSNP)
11 55,761,328 55,761,328 SYN A/G T/T rs56190402 (DbSNP)
11 55,761,338 55,761,338 NS C/G C/S rs58625186 (DbSNP)
11 55,761,528 55,761,528 NS C/T A/T rs35607186 (DbSNP)
11 55,761,738 55,761,738 SYN G/T R/R rs2128152 (DbSNP)
11 55,761,786 55,761,786 NS A/C S/A rs61888467 (DbSNP)
11 55,762,060 55,762,060 SYN C/T L/L rs71490418 (DbSNP)
11 55,993,775 55,993,775 NS A/G M/T 1000GP (CEU)
11 55,993,780 55,993,780 SYN A/G I/I 1000GP (CEU)
11 55,993,805 55,993,805 NS G/A A/V 1000GP (CEU)
11 55,994,052 55,994,052 NS T/C T/A 1000GP (CEU, CHBJPT)
11 55,994,310 55,994,310 NS A/C S/A 1000GP (CEU)
11 55,994,584 55,994,584 SYN T/C L/L 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
11 54,835,623 55,879,426 CopyNumber Variation_8690 (DGV)
11 55,153,930 55,816,828 CopyNumber Variation_0308 (DGV)
11 55,683,109 55,833,490 CopyNumber Variation_85786 (DGV)
11 55,685,556 55,796,170 CopyNumber Variation_48845 (DGV)
11 55,685,556 55,819,544 CopyNumber Variation_29912 (DGV), Variation_48846 (DGV)
11 55,685,556 55,836,620 CopyNumber Variation_48847 (DGV)
11 55,685,799 55,842,512 CopyNumber Variation_9189 (DGV)
11 55,689,863 55,849,156 CopyNumber Variation_2927 (DGV)
11 55,710,709 55,787,839 CopyNumber Variation_1245 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

S294N M284T Y278H A274V C255S T192A L166S S106A % Freq CORP
1 N M Y A C T L S 79.57 0.135
2 N M Y A C A L S 7.91 0.135
3 N M Y V C T L A 4.15 0.135
4 S M Y A C T L S 3.00 0.135
5 N T Y A C A L S 2.53 0.135
6 N M Y A S T L S 0.77 0.135
7 N M H A C T L S 0.69 0.135
8 N M Y V C T L S 0.54 0.135
9 N M Y A C T L A 0.38 0.135
10 N M Y A C T S S 0.38 0.135
11 N T Y A C T L S 0.08 0.135

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5F1.aApr07-unspliced main_exon 3UTR chr11 55,993,681 55,993,684 -
CDS chr11 55,993,684 55,994,625 -
5UTR chr11 55,994,625 55,994,627 -