Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5F2P Olfactory Receptor

Gene Symbol OR5F2P1 (View this gene in GeneCards)
Family 5
Subfamily F
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-164, OR11-157, HsOR11.11.40P, ORL3575
External Ids HGNC: 15286   GeneBank: AB065659, AB065843, AF546630-AF546643, BK004579, BK004766, NG_004193   ORDB: ORL3575   
Build #39 labels OR5F2P
Chromosomal location 11:56,015,017-56,015,957 (-)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5F1 91.08% 314

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5F2 86% 311
Mouse Or5w1 55% 312
Rat Or8h10 55% 309
Cow OR5F2B 85% 314
Cow OR5F2 85% 314
Cow OR5F2C 84% 314
Orang OR5E1P 55% 311
Horse OR5F11P 77% 302
Chimp OR5F2 96% 314

Expression evidences

Source Accession
mRNA BC101240

Sequence information

Nucleotide sequence ATGACCAGAAAAAATTATACCTCACTGACTGAGTTCATCCTATTGGGATTAGCAGACACG
CTGGAGCTACAGATTATCCTCTTTCTGTTATTTCTTGTGATTTACACACTTACCGTACTG
GGAAATATCGGGATGATCCTCTTAATCAGGATCGATTCCCGGCTTCACACACCCATGTAT
TTCTTCCTGGTTAACCTGTCCTTTGTGGACATTTGTTACTCAACCACCATCACCCCAAAG
ATGCTGGCAGATTTATTATCAGAGAAGAAAACCATCTCTTTTGCTGGCTGCTTCCTACAG
ATGTACTTCTTTATCGCCCTGGCGACAACCGAATGCATCCTCTTTGGGTTAATGGCCTAT
GACCGGTATGTGACCATATGTCGCCCGCTGCTTTACTCCTTGATCATGTCCAGGACAGTC
TGCCTAAAAATGGCAGCCGGGGCTTTTGCTGCAGGGTTGCTGAACTCCATGGTCAACACT
AGCTATGTCAGCAGCTTGTCATTCTGTGGCTCCAATGTCATCCATCACTTCTTCTGCAAC
AGTCCCCCACTTTTTAAGCTTTCTTGTTCTGACACACACTTGAAGGAAAGCATATTTTCC
ACTTTTGCTGGTGTGAATAAGGTCGGGGCTCTGCTTGTCATCCTCTCCTCCTATTCCTAC
GTTCTCTTCTCCATTTTTTCTATGCATTCAGGGGAGGGGAGGCACAGAGCTTTCTCCACG
TGTGCCTCTCACCTGACAGCCATAATCCTCTTCTACACCACCTCCATCTATACCTACCTG
AGACCTAGTTCCAGCTACTCCCTGATCAGGACAAAGTGGTTTCTGTGTTCTACACAGTGG
TGATCCCCATATTGAATCCTCTGATCTACAGCCTCAGGAATAAGGAAGTAAAGAAGGCTT
TAGCGAATGTAATTAGCAGGAAAAGGATCCCTTCATTTCTG
Conceptual translation MTRKNYTSLTEFILLGLADTLELQIILFLLFLVIYTLTVLGNIGMILLIRIDSRLHTPMY
FFLVNLSFVDICYSTTITPKMLADLLSEKKTISFAGCFLQMYFFIALATTECILFGLMAY
DRYVTICRPLLYSLIMSRTVCLKMAAGAFAAGLLNSMVNTSYVSSLSFCGSNVIHHFFCN
SPPLFKLSCSDTHLKESIFSTFAGVNKVGALLVILSSYSYVLFSIFSMHSGEGRHRAFST
CASHLTAIILFYTTSIYTYLRPSSSYSL/QDKVVSVFYTVVIPILNPLIYSLRNKEVKK
ALANVISRKRIPSFL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP T/G 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 55,782,600 55,782,600 SNP G/T rs67563695 (DbSNP)
11 55,782,660 55,782,660 SNP A/G rs2512922 (DbSNP)
11 55,782,773 55,782,773 SNP A/C rs7952321 (DbSNP)
11 55,782,814 55,782,814 SNP G/T rs1979464 (DbSNP)
11 55,782,896 55,782,896 SNP C/T rs7933186 (DbSNP)
11 55,782,946 55,782,946 SNP A/G rs7929796 (DbSNP)
11 55,782,994 55,782,994 SNP A/C rs35601374 (DbSNP)
11 55,783,058 55,783,058 SNP C/T rs7933387 (DbSNP)
11 55,783,061 55,783,061 SNP C/T rs7933389 (DbSNP)
11 55,783,155 55,783,155 SNP A/G rs34107711 (DbSNP)
11 55,783,208 55,783,207 Ins(1) -/C rs34538445 (DbSNP)
11 55,783,220 55,783,220 SNP A/T rs61888539 (DbSNP)
11 56,015,122 56,015,122 SNP T/A 1000GP (CEU)
11 56,015,124 56,015,124 SNP T/G 1000GP (CEU, CHBJPT)
11 56,015,184 56,015,184 SNP G/A 1000GP (CEU, CHBJPT)
11 56,015,297 56,015,297 SNP C/A 1000GP (CEU)
11 56,015,420 56,015,420 SNP T/C 1000GP (CEU)
11 56,015,470 56,015,470 SNP A/G 1000GP (CEU)
11 56,015,518 56,015,518 SNP C/A 1000GP (CEU, CHBJPT)
11 56,015,582 56,015,582 SNP T/C 1000GP (CEU)
11 56,015,585 56,015,585 SNP T/C 1000GP (CEU)
11 56,015,744 56,015,744 SNP A/T 1000GP (CEU)

Variations - CNVs

Chr Start End Type Sources
11 54,835,623 55,879,426 CopyNumber Variation_8690 (DGV)
11 55,153,930 55,816,828 CopyNumber Variation_0308 (DGV)
11 55,683,109 55,833,490 CopyNumber Variation_85786 (DGV)
11 55,685,556 55,796,170 CopyNumber Variation_48845 (DGV)
11 55,685,556 55,819,544 CopyNumber Variation_29912 (DGV), Variation_48846 (DGV)
11 55,685,556 55,836,620 CopyNumber Variation_48847 (DGV)
11 55,685,799 55,842,512 CopyNumber Variation_9189 (DGV)
11 55,689,863 55,849,156 CopyNumber Variation_2927 (DGV)
11 55,710,709 55,787,839 CopyNumber Variation_1245 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5F2P.aApr07-unspliced main_exon CDS_partial chr11 56,015,019 56,015,956 -