Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5G1P Olfactory Receptor

Gene Symbol OR5G1P1 (View this gene in GeneCards)
Family 5
Subfamily G
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-104, OR11-218, OR11-211, OR93, OR93, OR93Hum, HsOR11.11.91P, ORL3113
External Ids HGNC: 8344   GeneBank: AB065499, AF045576, AF399369, BK004646, BK004764   ORDB: ORL3113   
Build #39 labels OR5G1P
Chromosomal location 11:56,775,265-56,776,206 (-)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5G3P 63.02% 311
OR5G4P 69.46% 298
OR5G5P 63.34% 311

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5G1 87% 314
Mouse Or5g9 78% 310
Rat Or5g9 78% 310
Cow OR5G1BP 78% 312
Orang OR5G1 93% 314
Horse OR5G1 83% 316
Chimp OR5G1 97% 314
Chimp OR5G1CP 96% 313

Expression evidences

Source Accession
mRNA AB529232

Sequence information

Nucleotide sequence ATGGCTAATGAAAACTACACAAAGGTCACCTAATTCATTTTCACAGGCTTGAATTACAAT
CCTCAGTTGCAGGTCTTCCTTTTCCTACTCTTTCTGACAACTTTCTATGTCATCAATGTA
ACTGGAAACTTGGGAATGATTGTCCTCATCCGAATTGATTCCCGCCTTCACACACCCATG
TACTTTTTCCTCAGCCACCTGTCCTTTGTGGACACCTGCTTCTCCTCAGTTGTGAGCCCC
AAGATGCTCACTGACTTCTTTGTGAAGAGGAAAGCCATTTCTTTCCTTGGCTGTGCTTTG
CAGCAGTGGTTCTTTGGGTTCTTTGTGGCAGCAGACTGTTTCCTCTTGGAGTCCATGGCC
TATGACTGCTATGTGGCCATCTGTAACCCATTGTTATACTCAGTTGCTATGTCCCAGAGG
CTCTGCATCCAGCTAGTGGTGGGTCCCTATGTCATTGGACTCATGAATACCATGACTCAC
ACAACAAATGCATTTTGTCTCCCTTTTTGTGGCCCTAATGTCATCAATCCTTTCTTCTGT
GATATGTCCCCCTTACTTTCCCTTGTATGTGCTGATACCAGGCTCAATAAGTTGGCAGTT
TTCATCGTGGCTGGAGCTGTGGGAGTCTTCAGTGGTCTGACTATCCTGATTTCCTACATT
TACATCCTCATGGCCATCCTGAGGATCCGCTCTGCTGATGGGAGGTGCAAAACCTTTTCT
ACTTGCTCTTCTCACCTGACAGCTGTTTTCATCTCGTATGGTACCCTTTTCTTTATTTAT
GTACATCCCAGTGCAACCTTCTCCCTGGATCTCAATAAAGTAGTGTCTGTGTTTTACACA
GCAGTGATTCCTATGTTGAACCCACTTATCTACAGCTTGAGAAACAAGGAAGTCAAAGAT
GCCATCCACAGGACTGTCACTCAGAGGAAGTTTTGCAAGGCC
Conceptual translation MANENYTKVTXIFTGLNYNPQLQVFLFLLFLTTFYVINVTGNLGMIVLIRIDSRLHTPM
YFFLSHLSFVDTCFSSVVSPKMLTDFFVKRKAISFLGCALQQWFFGFFVAADCFLLESMA
YDCYVAICNPLLYSVAMSQRLCIQLVVGPYVIGLMNTMTHTTNAFCLPFCGPNVINPFFC
DMSPLLSLVCADTRLNKLAVFIVAGAVGVFSGLTILISYIYILMAILRIRSADGRCKTFS
TCSSHLTAVFISYGTLFFIYVHPSATFSLDLNKVVSVFYTAVIPMLNPLIYSLRNKEVKD
AIHRTVTQRKFCKA

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 56,543,175 56,543,175 Del(1) -/A rs34410062 (DbSNP)
11 56,543,499 56,543,499 SNP A/C rs56139492 (DbSNP)
11 56,542,781 56,542,781 SNP A/G rs534606 (DbSNP)
11 56,542,818 56,542,818 SNP A/G rs1943638 (DbSNP)
11 56,542,928 56,542,928 SNP A/G rs1943639 (DbSNP)
11 56,543,538 56,543,538 SNP A/G rs73478426 (DbSNP)
11 56,542,759 56,542,759 SNP C/T rs55688907 (DbSNP)
11 56,542,757 56,542,757 SNP C/T rs1943637 (DbSNP)
11 56,543,612 56,543,612 SNP C/T rs12416731 (DbSNP)
11 56,775,281 56,775,281 SNP C/T 1000GP (CEU, CHBJPT)
11 56,775,305 56,775,305 SNP G/A 1000GP (CEU, CHBJPT)
11 56,775,342 56,775,342 SNP G/A 1000GP (CEU, CHBJPT)
11 56,775,452 56,775,452 SNP G/A 1000GP (CEU, CHBJPT)
11 56,776,055 56,776,055 SNP C/T 1000GP (CEU)
11 56,776,136 56,776,136 SNP T/C 1000GP (CEU, CHBJPT)
11 56,775,284 56,775,284 SNP T/A 1000GP (CHBJPT)
11 56,775,990 56,775,990 SNP A/G 1000GP (CHBJPT)
11 100 -100 SNP C/T 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.