Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5G3P Olfactory Receptor

Gene Symbol OR5G3P1 (View this gene in GeneCards)
Family 5
Subfamily G
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-213, HsOR11.11.94P
External Ids HGNC: 15287   GeneBank: AB065498, BK004647, NG_002406   
Build #39 labels OR5G3P, OR5G6P
Chromosomal location 11:56,819,576-56,820,516 (-)
Cluster 11@56
Synteny CLIC#26
Remarks Segregating Pseudo Gene, a polymorphism of C->del at position 343

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5G5P 70.7% 314

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5G3 81% 313
Chimp CONTIG*********** 99% 314
Mouse Or5g29 78% 314
Rat Or5g29 79% 313
Cow OR5G34 78% 314

Expression evidences

Source Accession
mRNA AB231739

Sequence information

Nucleotide sequence ATGGAAGATAAGAACCAGACAGTAGTGACTGAATTTCTCTTATTGGGCCTCACAGATCAT
CCCTATCAGAAGATTGTTCTCTTCTTCATGTTTCTCTTTGTTTATCTTATCACCCTGGGA
GGTAACTTGGGGATGATCACTCTCATATGGATTGATCCCAGACTCCACACTCCTATGTAC
TTTTTTCTTAGGCACTTGTCCTTTGTAGATATTTGTTCCTCTTCTTCTGTTGTGCCTAAG
ATGCTGTGTAATATCTTTGCAGAGAAAAAAGACATCACTTTTCTGGGTTGTGCTGCACAG
ATGTGGTTCTTTGGTCTCTTTGAGGCAGCTGAGTGTTTTCTCTGGCTGCCATGGCATATG
ACCGGTATGTGGCCATCTGCAAGCCCTTGTTGTATACGCTCATTATGTCTCAGCAGGTCT
GTATGCAGCTGGTGGTAGGGCCTTATGCCATGGCTCTTATAAGCACCATGACTCATACAA
TTTTCACTTTTTGCTTACCCTTTTGTGGTTCAAATATTATCAATCACTTTTTCTGTGATA
TTTTTCCACTGCTTTCCCTAGCATGTGCAGACACCTGGGTGAATAAATTTGTGCTGTTTG
TCTTGGCTGGAGCTATAGGAGTACTCAGTGGTCTGATCATCATGGTCTCCTATATTTGCA
TCCTGATGACCATCTTGAAGATCCAGACTGCTGATGGGAAGCAAAAAGCTTTCTTCACCT
GTTTTTCTCACCTTGCGGCTGTCTCCATCCTGTATGGGACTCTTTTCTTGATTTATGTTC
GGCCAAGTTCAAGTTCCTCCCTGGGTATCTATAAAGTGATTTCTCTATTTTATACTGTGG
TAATCCCCATGGTTAACCCCCTTATTTACAGCTTGAGGAATAAGGAGGTGAAAGATGCAT
TCAGAAGAAAAATTGAGAGGAAAAAATTTATTATAGGTAGG
Conceptual translation MEDKNQTVVTEFLLLGLTDHPYQKIVLFFMFLFVYLITLGGNLGMITLIWIDPRLHTPMY
FFLRHLSFVDICSSSSVVPKMLCNIFAEKKDITFLGCAAQMWFFGLFEAAECF/LAAMA
YDRYVAICKPLLYTLIMSQQVCMQLVVGPYAMALISTMTHTIFTFCLPFCGSNIINHFFC
DIFPLLSLACADTWVNKFVLFVLAGAIGVLSGLIIMVSYICILMTILKIQTADGKQKAFF
TCFSHLAAVSILYGTLFLIYVRPSSSSSLGIYKVISLFYTVVIPMVNPLIYSLRNKEVKD
AFRRKIERKKFIIGR

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 56,587,505 56,587,505 Del(1) -/A rs59922864 (DbSNP)
11 56,587,652 56,587,651 Ins(1) -/G rs61392974 (DbSNP)
11 56,587,056 56,587,056 SNP A/C rs61108658 (DbSNP)
11 56,587,975 56,587,975 SNP A/C rs1788998 (DbSNP)
11 56,587,630 56,587,630 SNP A/G rs11823625 (DbSNP)
11 56,587,421 56,587,421 SNP G/T rs7125364 (DbSNP)
11 56,587,406 56,587,406 SNP G/T rs41414647 (DbSNP)
11 56,819,580 56,819,580 SNP C/A 1000GP (CEU, CHBJPT)
11 56,819,930 56,819,930 SNP T/G 1000GP (CEU, CHBJPT)
11 56,819,945 56,819,945 SNP G/T 1000GP (CEU)
11 56,820,154 56,820,154 SNP G/A 1000GP (CEU, CHBJPT)
11 56,820,499 56,820,499 SNP C/A 1000GP (CEU, CHBJPT)
11 100 -100 SNP C/A 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 56,585,052 56,588,092 Deletion #225 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.