Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5H1 Olfactory Receptor

Gene Symbol OR5H11 (View this gene in GeneCards)
Family 5
Subfamily H
Pseudogene No
CORP pseudogene probability score 0.03 (functional)
Aliases HSHTPCRX14, HsOR3.3.4, ORL47
External Ids HGNC: 8346   GeneBank: HSHTPRX14, NM_001005338   ORDB: ORL47   
Build #39 labels OR5H1
Chromosomal location 3:98,132,698-98,133,636 (+)
Cluster 3@98
Synteny CLIC#9
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5H15 94.57% 313

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5H13 78% 308
Chimp CONTIG405.163-13972 97% 313
Chimp CONTIG405.167-12538 95% 313
Chimp CONTIG405.164-34869 92% 313
Mouse Or5h26 77% 308
Rat Or5h17c 76% 306
Cow OR5H13 78% 308

Expression evidences

Source Accession
mRNA AB528772

Sequence information

Nucleotide sequence ATGGAAGAGGAAAATGCAACATTGCTGACAGAGTTTGTTCTCACAGGATTTTTATATCAA
CCACAGTGGAAAATACCCCTGTTCCTGGCATTCTTGGTAATATATCTCATCACCATCATG
GGGAATCTTGGTCTGATTGCTGTCATCTGGAAAGACCCTCACCTTCATATCCCAATGTAC
TTACTCCTTGGGAATTTAGCTTTTGTGGATGCTTGGATATCATCCACAGTGACCCCAAAG
ATGCTGAATAACTTCTTAGCTAAGAGTAAGATGATATCTCTCTCTGAATGCAAGATACAG
TTTTTTTCGTTTGCAATCAGTGTAACCACGGAATGTTTTCTCTTGGCAACGATGGCATAT
GATCGCTATGTAGCCATATGCAAACCTTTACTTTATCCAGCCATTATGACCAATGGACTG
TGCATCCGGCTATTAATCTTGTCATATGTAGGTGGTATTCTTCATGCTTTAATCCATGAA
GGATTTTTATTCAGACTAACCTTCTGTAACTCCAACATAGTACATCACATTTACTGTGAC
ACTATCCCATTGTCTAAGATTTCTTGTACTGATTCTTCTATTAATTTTCTAATGGTTTTT
ATTTTCTCAGGTTCAATTCAGGTATTCAGCATTGTGACTATTCTTGTATCTTATACATTT
GTTCTCTTCGCAATCTTAAAAAAGAAATCTGATAAAGGTGTAAGGAAAGCCTTTTCCACC
TGTGGAGCCCATCTCTTCTCTGTCTCTTTATACTATGGACCCCTTCTCTTCATTTATGTG
GGCCCTGCATCTCCGCAAGCAGATGATCAAGATATGGTGGAGCCTCTATTCTACACTGTC
ATCATTCCTTTGTTAAATCCTATCATCTACAGTCTGAGAAATAAGCAAGTCACAGTTTCA
TTCACAAAAATGTTAAAAAAACATGTTAAGGTTTCATAC
Conceptual translation MEEENATLLTEFVLTGFLYQPQWKIPLFLAFLVIYLITIMGNLGLIAVIWKDPHLHIPMY
LLLGNLAFVDAWISSTVTPKMLNNFLAKSKMISLSECKIQFFSFAISVTTECFLLATMAY
DRYVAICKPLLYPAIMTNGLCIRLLILSYVGGILHALIHEGFLFRLTFCNSNIVHHIYCD
TIPLSKISCTDSSINFLMVFIFSGSIQVFSIVTILVSYTFVLFAILKKKSDKGVRKAFST
CGAHLFSVSLYYGPLLFIYVGPASPQADDQDMVEPLFYTVIIPLLNPIIYSLRNKQVTVS
FTKMLKKHVKVSY

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
3 100 -100 NS G/A A/T 1000GP (YRI, YRI, YRI)
3 97,851,892 97,851,892 SYN A/G T/T rs5009897 (DbSNP)
3 97,851,983 97,851,983 NS A/T T/S rs5009896 (DbSNP)
3 97,851,989 97,851,989 NS A/G I/V rs5009895 (DbSNP)
3 97,851,993 97,851,993 NS C/G A/G rs5009894 (DbSNP)
3 97,851,995 97,851,995 NS C/G R/G rs62269699 (DbSNP)
3 97,851,998 97,851,998 NS A/C I/L rs9845327 (DbSNP)
3 97,852,040 97,852,040 NS A/T T/S rs5009893 (DbSNP)
3 97,852,058 97,852,058 NS A/G I/V rs62269700 (DbSNP)
3 97,852,066 97,852,066 SYN C/T H/H rs62269701 (DbSNP)
3 97,852,083 97,852,083 NS C/T T/I rs9826076 (DbSNP)
3 97,852,195 97,852,195 SYN C/T Y/Y rs72933949 (DbSNP)
3 97,852,211 97,852,211 NS A/G T/A rs72926074 (DbSNP)
3 97,852,229 97,852,229 NS A/T T/S rs9849637 (DbSNP)
3 97,852,335 97,852,335 NS C/T P/L rs73133252 (DbSNP)
3 98,133,385 98,133,385 NS T/A S/T 1000GP (CEU, CHBJPT)
3 98,133,447 98,133,447 SYN A/G L/L 1000GP (CEU)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

A119T R143Q A224T S230T % Freq CORP
1 A R A S 75.88 0.084
2 A R A T 21.04 0.084
3 T R T S 2.07 0.123
4 A Q A T 0.77 0.084
5 A Q A S 0.15 0.084
6 A R T T 0.08 0.084

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5H1.aApr07-unspliced main_exon CDS chr3 98,132,698 98,133,636 +
3UTR chr3 98,133,636 98,133,639 +