Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5H14 Olfactory Receptor

Gene Symbol OR5H141 (View this gene in GeneCards)
Family 5
Subfamily H
Pseudogene No
CORP pseudogene probability score 0.1 (functional)
Aliases HsOR3.3.5
External Ids HGNC: 31286   GeneBank: NM_001005514   
Build #39 labels
Chromosomal location 3:98,149,386-98,150,315 (+)
Cluster 3@98
Synteny CLIC#9
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5H1 87.99% 308
OR5H3P 89.03% 310
OR5H6 86.69% 308

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5H13 76% 308
Chimp CONTIG405.164-15529 94% 310
Chimp CONTIG405.169-559 91% 310
Chimp CONTIG405.171-23594 89% 308
Mouse Or5h17 75% 306
Rat Or5h17 75% 306
Cow OR5H13 78% 308

Expression evidences

Source Accession
mRNA BC136984

Sequence information

Nucleotide sequence ATGGAAGAGGAAAATGCAACATTGCTGACAGAGTTTGTTCTCACAGGATTTTTATATCAA
CCACAGTGGAAAATACCCCTGTTCCTGGCATTCTTGGTAATATATCTCATCACCATCATG
GGGAATCTTGGTCTGATTGCTGTCATCTGGAAAGACCCTCATCTTCATATCCCAATGTAC
TTACTCCTTGGGAATTTAGCTTTTGTGGATGCTTTGTTATCATCCTCAGTGACTCTGAAG
ATGCTGATCAACTTCTTAGCTAAGAGTAAGATGATATCTCTCTCTGAATGCAAGATACAG
TTGTTTTCGTTTGCAATCAGTGTAACCACGGAATGTTTTCTCTTGGCAACAATGGCATAT
GATCGCTATGTAGCCATATGCAAACCCTTACTTTATCCAGCCATTATGACCAATGGACTG
TGCATCCGGCTATTAATCTTGTCATATGTAGGTGGTCTTCTTCATGCTTTAATCCATGAA
GGATTTTTATTCAGACTAACCTTCTGTAACTCCAACATAATACAACACTTTTACTGTGAC
ATTATCCCATTGTTAAAGATTTCTTATACTGATTCCTCTATTAACTTTCTAATGGTTTTT
ATTTTTGCAGGTTCAATTCAAGTTTTTACCATAGGGACTGTTCTTATATCTTACATATTT
GTCCTCTATACAATCTTGAAAAAGAAGTCTGTCAAAGGTATGAGAAAAGCCTTCTCCACC
TGTGGAGCTCATCTCTTATCTGTATCTTTATACTATGGGCCCCTCGCCTTCATGTATATG
GGCTCTGCATCCCCACAGGCTGATGACCAAGATATGATGGAGTCTCTATTTTACACTGTC
ATAGTTCCTTTATTAAATCCCATGATCTACAGCCTGAGAAACAAGCAAGTAATAGCTTCA
TTCACAAAAATGTTCAAAAGAAATGATGTT
Conceptual translation MEEENATLLTEFVLTGFLYQPQWKIPLFLAFLVIYLITIMGNLGLIAVIWKDPHLHIPMY
LLLGNLAFVDALLSSSVTLKMLINFLAKSKMISLSECKIQLFSFAISVTTECFLLATMAY
DRYVAICKPLLYPAIMTNGLCIRLLILSYVGGLLHALIHEGFLFRLTFCNSNIIQHFYCD
IIPLLKISYTDSSINFLMVFIFAGSIQVFTIGTVLISYIFVLYTILKKKSVKGMRKAFST
CGAHLLSVSLYYGPLAFMYMGSASPQADDQDMMESLFYTVIVPLLNPMIYSLRNKQVIAS
FTKMFKRNDV

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
3 100 -100 NS G/A M/I 1000GP (YRI)
3 100 -100 SYN T/C F/F 1000GP (YRI)
3 97,868,258 97,868,258 NS C/T T/I rs72927992 (DbSNP)
3 97,868,296 97,868,296 NS C/T R/W rs7433910 (DbSNP)
3 97,868,417 97,868,416 Ins(1) -/C rs34013694 (DbSNP)
3 97,868,419 97,868,419 NS A/G R/G rs4241468 (DbSNP)
3 97,868,422 97,868,422 NS A/G N/D rs73131400 (DbSNP)
3 97,868,614 97,868,614 NS C/G P/A rs72932878 (DbSNP)
3 97,868,616 97,868,616 SYN C/T P/P rs4379004 (DbSNP)
3 97,868,766 97,868,766 NS G/T W/C rs12638928 (DbSNP)
3 97,868,795 97,868,795 NS A/G Y/C rs4857076 (DbSNP)
3 97,868,856 97,868,856 SYN C/T F/F rs72927996 (DbSNP)
3 97,868,970 97,868,970 SYN A/T S/S rs12639519 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
3 97,868,130 97,871,159 CopyNumber #36 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

M59V G64R K98E A134V R143W Y189C M234I A237T A256D N294K % Freq CORP
1 M R K A R C M A A N 47.00 0.200
2 M G K A R Y M A A N 35.79 0.206
3 M R K A W C M A A N 9.68 0.200
4 M G K A R C M A A N 2.15 0.200
5 M G K V R C I T A K 1.00 0.417
6 M R K A R C I T A K 0.84 0.417
7 M R K A R C M A A K 0.61 0.200
8 M G K A R C I T A K 0.54 0.417
9 M G E A R C M A A N 0.38 0.200
10 M G K A W Y M A A N 0.23 0.206
11 M G K A W C M A A N 0.23 0.200
12 M R K A R Y M A A N 0.23 0.206
13 M R K A W C I T A K 0.15 0.417
14 M G K V R C M A A K 0.15 0.200
15 M G K A R C M A A K 0.15 0.200
16 M G E A W C M A A N 0.15 0.200
17 V G K A R Y M A A N 0.15 0.683
18 M R K V R C M A A N 0.15 0.200
19 M G K A R Y M A D N 0.15 0.206
20 M R K A W Y M A A N 0.08 0.206
21 V R K A R C M A A N 0.08 0.675
22 M R K A R C I A A K 0.08 0.200

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5H14.aApr07-unspliced main_exon CDS chr3 98,149,386 98,150,315 +
3UTR chr3 98,150,315 98,150,318 +