Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5H3P Olfactory Receptor

Gene Symbol OR5H3P1 (View this gene in GeneCards)
Family 5
Subfamily H
Pseudogene Yes
CORP pseudogene probability score
Aliases OR3-4, HsOR3.3.8P, ORL3107
External Ids HGNC: 14753   GeneBank: BK004591, NG_002237   ORDB: ORL3107   
Build #39 labels OR5H3P
Chromosomal location 3:98,207,423-98,208,338 (+)
Cluster 3@98
Synteny CLIC#9
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5H1 87.66% 308
OR5H14 89.03% 310
OR5H15 86.04% 308

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5H13 76% 308
Mouse Or5h26 73% 309
Rat Or5h26 73% 309
Cow OR5H13 77% 308
Orang OR5H6 85% 308
Orang OR5H8 83% 308
Orang OR5H8BP 83% 256
Horse OR5H40 76% 308
Chimp OR5H14BP 88% 310
Chimp OR5H14 87% 310
Chimp OR5H1 88% 308

Expression evidences

Source Accession
ESTs AI656798

Sequence information

Nucleotide sequence ATGGAAGAGGAAAATGCAACATTGCTGACAGAGTTTGTTCTCACAGGACTTTTATATCAA
CCACAGTGGAAAATACCCCTGTTCCTGACATTCTTGGTAATATATCTCATCACCATCATG
GGGAATCTTGGTCTGATTGCTGTCATCTGGAAAGACCCTCACCTTCAGATCCCAATGTAC
TTACTCCTCGGGAATTTAGCTTTTGTAGATGCTTGGATATCATCTACAGTGACTCCAAAG
ATGCTGAATAACTTCTTAGCTAAGAGTAAGATGGTATCTCTGCCTGAAAGCAAAATACAG
TTTTTTTCGTTTGCAATCAGTGTAACCACTGAATGTTTTCTCTTGGCAACAATGGCATAT
GATCGCTATGTAGCCATATGCAAACCTTTACTTTATCCAGCCATTATGACCAATGGACTG
TGCATCCGGCTATGTAGGTGGTCTTCTTCATGCTTTAATCCATGAAGGATTTTTATTCAG
ACTAACCTTCTGTAACTCCAACGTAGTACACCACATTTACTGTGACATTATCCCATTGTC
TAAGATTTCTTGTACTGATTCTTCTATTAATTTTCTAATGGTTTTTATTTTCTCAGGTTC
AATTCAAGTTTTCACCATTGGGACTGGTCTTATATCTTATACATTTGTCCTCTTTACAAT
CTTGAAAAAGAAATCTGTCAAAGGTATAAGAAAAGCCTTCTCCACCTGTGGAGCTCATCT
CTTATCTGTATCTTTATACCATGGGCCCCTCGACTTCATGTATATGGGCTCTGCATCCCC
ACAGGCTGATGACGAAGACATGATGGAGTCTCTATTTTACACTGTCATAGTTCCTTTATT
AAATCCCATGACCTACAGCCTGAGAAACAAACAAGTAATAGCTTCATTCACAAAAATGTT
CAAAAGAAATAATATT
Conceptual translation MEEENATLLTEFVLTGLLYQPQWKIPLFLTFLVIYLITIMGNLGLIAVIWKDPHLQIPMY
LLLGNLAFVDAWISSTVTPKMLNNFLAKSKMVSLPESKIQFFSFAISVTTECFLLATMAY
DRYVAICKPLLYPAIMTNGLCIRL\GGLLHALIHEGFLFRLTFCNSNVVHHIYCDIIPL
SKISCTDSSINFLMVFIFSGSIQVFTIGTGLISYTFVLFTILKKKSVKGIRKAFSTCGAH
LLSVSLYHGPLDFMYMGSASPQADDEDMMESLFYTVIVPLLNPMTYSLRNKQVIASFTKM
FKRNNI

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
3 100 -100 SNP G/A 1000GP (YRI, YRI, YRI, YRI, YRI)
3 97,926,354 97,926,354 SNP A/G rs9837299 (DbSNP)
3 97,926,625 97,926,625 SNP A/G rs9837684 (DbSNP)
3 97,926,693 97,926,693 SNP C/T rs9818544 (DbSNP)
3 97,926,698 97,926,697 Ins(14) -/TATTAATCTTGTCA rs66499506 (DbSNP)
3 97,926,701 97,926,700 rescued_Ins(14) -/TAATCTTGTCATAT rs72081882 (DbSNP)
3 97,926,733 97,926,733 SNP C/G rs9855110 (DbSNP)
3 98,207,510 98,207,510 SNP A/G 1000GP (CEU, CHBJPT)
3 98,208,216 98,208,216 SNP G/A 1000GP (CEU)

Variations - CNVs

Chr Start End Type Sources
3 97,874,279 97,931,369 CopyNumber Variation_62080 (DGV)
3 97,899,419 97,939,393 CopyNumber Variation_68423 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.