Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5H5P Olfactory Receptor

Gene Symbol OR5H5P1 (View this gene in GeneCards)
Family 5
Subfamily H
Pseudogene Yes
CORP pseudogene probability score
Aliases OR3-3, HsOR3.3.7P, ORL3099
External Ids HGNC: 14765   GeneBank: BK004698, NG_002230   ORDB: ORL3099   
Build #39 labels OR5H5P
Chromosomal location 3:98,197,211-98,198,135 (+)
Cluster 3@98
Synteny CLIC#9
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5H14 82.64% 311
OR5H6 79.22% 308
OR5H7P 78.96% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5H13 71% 308
Mouse Or5h19 72% 306
Rat Or5h19-ps 71% 308
Cow OR5H13 72% 308
Orang OR5H8 77% 308
Horse OR5H8 71% 308
Chimp OR5H14BP 83% 310
Chimp OR5H14 83% 310
Chimp OR5H7 81% 308

Expression evidences

Source Accession
ESTs AW451975

Sequence information

Nucleotide sequence ATGGAAGAGAAAAATGCAACATTGCTGACAGAGTTTGTTCTCACATTATTTTTATATCAA
CCTCACTGGAAAATACCCCTGTTCCTGGCATTCTTGGTAATATATCTCATCACCATCTTT
GGGAATCTTGGTCTGATTGCTGTCGTATGGAAAGACCCTCACCTTCATATCCCAATATAC
TTATTCCTTGAGAATTTAGCTTTTGTGGATGATTTGTTATCATCCACATGACTCTGAAGA
TGCTGATCAACTTCTTCACTAAGAGTAAGTTGATTTCTCTCTGAATGCTGGATACATTTT
TTTTCCTTTGCAATTGGTGTAACCACAGAATGTTTTATCTTGGCAACAATGGCATATGAT
CGCTATGTAGCCATATGCAAACCTTTACTTTATCCAGTCATTATGACCAATGGACTGTGC
ATCTGGCTATTAATCTTGTCATTTCTAGGTGGCCTTCTTCATGCTTTAATTCATGAAGGT
TTTTTATAGATTAACCTTCTGTAATTCCAACACAATACATCACTTTTAATGTGACATTAT
CCCATTGTTAAAAATTTTCTGTACTGATTCTTCTATTAACTTTCCAATGGTTTTTATTTT
CTCATGTTCAATTCAAGTTTTCACCATTGGGACTGTTCTTGTATCTTATACATTTGTCCT
CTCTACAATCTTGAAAAAGAAGTCTGTCAAAGGCATAAGAAAAGACTTCTCCACCTGTGG
AGCTCATATCTTACCTGTATCTTTATACTATGGGCCCCTCGCCTTCATGTATGTGGGCTC
TGCATCCCAACGGGCTGATGACCAAGATATGATGGAGTCTCTATTTTACACTGTCATAGT
TCCTTTATTAAATCCCATGATCTACAGCCTGAGAAATAAGCAAGTAATAGATTCATTCAC
AAAAATGTTCAAAGGAAATAATGTT
Conceptual translation MEEKNATLLTEFVLTLFLYQPHWKIPLFLAFLVIYLITIFGNLGLIAVVWKDPHLHIPIY
LFLENLAFVDDLLSST/TLKMLINFFTKSKLISLXLDTFFFLCNWCN\ECFILATMA
YDRYVAICKPLLYPVIMTNGLCIWLLILSFLGGLLHALIHEGF\RLTFCNSNTIHHFX
DIIPLLKIFCTDSSINFPMVFIFSCSIQVFTIGTVLVSYTFVLSTILKKKSVKGIRKDFS
TCGAHILPVSLYYGPLAFMYVGSASQRADDQDMMESLFYTVIVPLLNPMIYSLRNKQVID
SFTKMFKGNNV

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
3 100 -100 SNP A/G 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
3 97,916,064 97,916,064 SNP A/G rs11706390 (DbSNP)
3 97,916,199 97,916,199 SNP A/G rs35393131 (DbSNP)
3 97,916,201 97,916,202 mnp AT/CC rs35879903 (DbSNP)
3 97,916,231 97,916,231 SNP A/G rs6765411 (DbSNP)
3 97,916,351 97,916,351 SNP C/T rs59017334 (DbSNP)
3 97,916,375 97,916,375 SNP A/G rs6765598 (DbSNP)
3 97,916,387 97,916,387 SNP C/T rs6768197 (DbSNP)
3 97,916,391 97,916,391 SNP A/C rs6765605 (DbSNP)
3 97,916,542 97,916,541 Ins(2) -/AC rs10684786 (DbSNP)
3 97,916,543 97,916,542 Ins(2) -/CA rs58417252 (DbSNP)
3 97,916,544 97,916,543 Ins(2) -/CA rs67206857 (DbSNP)
3 97,916,615 97,916,615 SNP A/G rs6776813 (DbSNP)
3 97,916,734 97,916,734 SNP A/G rs6765940 (DbSNP)
3 97,916,782 97,916,782 SNP A/C rs6766035 (DbSNP)
3 97,916,787 97,916,788 mnp GT/AC rs71623585 (DbSNP)
3 97,916,788 97,916,788 SNP C/T rs6802178 (DbSNP)
3 98,197,220 98,197,220 SNP A/G 1000GP (CEU, CHBJPT)
3 98,197,355 98,197,355 SNP G/A 1000GP (CEU, CHBJPT)
3 98,197,357 98,197,357 SNP A/C 1000GP (CEU)
3 98,197,358 98,197,358 SNP T/C 1000GP (CEU)
3 98,197,387 98,197,387 SNP A/G 1000GP (CEU, CHBJPT)
3 98,197,507 98,197,507 SNP T/C 1000GP (CEU, CHBJPT)
3 98,197,531 98,197,531 SNP A/G 1000GP (CEU, CHBJPT)
3 98,197,543 98,197,543 SNP T/C 1000GP (CEU, CHBJPT)
3 98,197,547 98,197,547 SNP A/C 1000GP (CEU, CHBJPT)
3 98,197,771 98,197,771 SNP G/A 1000GP (CEU, CHBJPT)
3 98,197,890 98,197,890 SNP A/G 1000GP (CEU, CHBJPT)
3 98,197,938 98,197,938 SNP A/C 1000GP (CEU, CHBJPT)
3 98,197,943 98,197,943 SNP A/G 1000GP (CEU, CHBJPT)
3 98,197,944 98,197,944 SNP C/T 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 116 (Hasin)
3 97,874,279 97,931,369 CopyNumber Variation_62080 (DGV)
3 97,887,491 97,919,363 CopyNumber Variation_37833 (DGV)
3 97,899,419 97,939,393 CopyNumber Variation_68423 (DGV)
3 97,908,878 97,924,741 CopyNumber Variation_68427 (DGV)
3 97,908,945 97,916,951 CopyNumber Variation_98383 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.