Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5H6 Olfactory Receptor

Gene Symbol OR5H61 (View this gene in GeneCards)
Family 5
Subfamily H
Pseudogene No
CORP pseudogene probability score
Aliases OR3-11, HsOR3.3.11, ORL3094
External Ids HGNC: 14767   GeneBank: AB065667, BK004374, NM_001005479   ORDB: ORL3094   
Build #39 labels OR5H6
Chromosomal location 3:98,264,333-98,265,259 (+)
Cluster 3@98
Synteny CLIC#9
Remarks Segregating Pseudo Gene, a nonsynonymous SNP in a highly conserved amino-acid (rs9289564 and rs9853887)

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5H14 86.69% 308
OR5H7P 89.64% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5H13 76% 308
Chimp CONTIG405.175-6895 96% 309
Mouse Or5h26 75% 308
Rat Or5h26 74% 308
Cow OR5H30 77% 306

Expression evidences

Source Accession
mRNA BC137524
GNF Atlas2 gnf1h01994_at

Sequence information

Nucleotide sequence ATGGAAGAGGAAAATGCAACATTGCTGACAGAGTTTGTTCTCACAGGATTTTTACATCAA
CCTGACTGTAAAATACCGCTCTTCCTGGCATTCTTGGTAATATATCTCATCACCATCATG
GGGAATCTTGGTCTAATTGTTCTCATCTGGAAAGACCCTCACCTTCATATCCCAATGTAC
TTATTCCTTGGGAGTTTAGCCTTTGTGGATGCTTCGTTATCATCCACAGTGACTCCGAAG
ATGCTGATCAACTTCTTAGCTAAGAGTAAGATGATATCTCTCTCTGAATGCATGGTACAA
TTTTTTTCCCTTGTAACCACTGTAACCACAGAATGTTTTCTCTTGGCAACAATGGCATAT
GATCGCTATGTAGCCATTTGCAAAGCTTTACTTTATCCAGTCATTATGACCAATGAACTA
TGCATTCAGCTATTAGTCTTGTCATTTATAGGTGGCCTTCTTCATGCTTTAATCCATGAA
GCTTTTTCATTCAGATTAACCTTCTGTAATTCCAACATAATACAACACTTTTACTGTGAC
ATTATCCCATTGTTAAAGATTTCCTGTACTGATTCCTCTATTAACTTTCTAATGGTTTTT
ATTTTCGCAGGTTCTGTTCAAGTTTTTACCATTGGAACTATTCTTATATCTTATACAATT
ATCCTCTTTACAATCTTAGAAAAGAAGTCTATCAAAGGGATACGAAAAGCTGTCTCCACC
TGTGGGGCTCATCTCTTATCTGTATCTTTATACTATGGCCCCCTCACCTTCAAATATCTG
GGCTCTGCATCTCCGCAAGCAGATGACCAAGATATGATGGAGTCTCTATTTTACACTGTC
ATAGTTCCTTTATTAAATCCCATGATCTACAGCCTGAGAAACAAGCAAGTAATAGCTTCA
TTCACAAAAATGTTCAAAAGCAATGTT
Conceptual translation MEEENATLLTEFVLTGFLHQPDCKIPLFLAFLVIYLITIMGNLGLIVLIWKDPHLHIPMY
LFLGSLAFVDASLSSTVTPKMLINFLAKSKMISLSECMVQFFSLVTTVTTECFLLATMAY
DRYVAICKALLYPVIMTNELCIQLLVLSFIGGLLHALIHEAFSFRLTFCNSNIIQHFYCD
IIPLLKISCTDSSINFLMVFIFAGSVQVFTIGTILISYTIILFTILEKKSIKGIRKAVST
CGAHLLSVSLYYGPLTFKYLGSASPQADDQDMMESLFYTVIVPLLNPMIYSLRNKQVIAS
FTKMFKSNV

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
3 97,983,503 97,983,511 In-Del(9) -/GGTTACAGT rs11279406 (DbSNP)
3 97,983,396 97,983,395 Ins(9) -/ACTGTAACC rs11280482 (DbSNP)
3 97,983,265 97,983,265 NS A/C E/A rs4241472 (DbSNP)
3 97,983,699 97,983,699 NS A/C K/Q rs58475490 (DbSNP)
3 97,983,391 97,983,391 NS A/C/G multi/S rs2173236 (DbSNP)
3 97,983,981 97,983,981 NS A/G N/D rs9871143 (DbSNP)
3 97,983,942 97,983,942 NS A/G T/A rs9853906 (DbSNP)
3 97,983,561 97,983,561 NS C/G P/A rs9289564 (DbSNP)
3 97,983,253 97,983,253 NS C/T P/L rs36040433 (DbSNP)
3 97,983,711 97,983,711 NS C/T R/C rs9853887 (DbSNP)
3 97,983,664 97,983,664 NS C/T S/L rs16846784 (DbSNP)
3 97,983,374 97,983,374 SYN A/G L/L rs4857358 (DbSNP)
3 97,983,257 97,983,257 SYN C/G L/L rs2132894 (DbSNP)
3 97,983,740 97,983,740 SYN C/T S/S rs36116717 (DbSNP)
3 97,983,309 97,983,309 SYN C/T L/L rs73854590 (DbSNP)
3 98,265,098 98,265,098 NS A/G T/A 1000GP (CEU, CHBJPT)
3 98,264,413 98,264,413 SYN C/G L/L 1000GP (CEU, CHBJPT)
3 98,264,547 98,264,547 NS C/T S/L 1000GP (CEU)
3 98,265,137 98,265,137 NS G/A D/N 1000GP (CEU)
3 98,264,758 98,264,758 SYN T/C I/I 1000GP (CHBJPT)
3 100 -100 NS C/T H/Y 1000GP (YRI, YRI, YRI)
3 100 -100 SYN C/G L/L 1000GP (YRI, YRI)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

E27Q H35Y A46E I55V L64V L130I A145P I158N Q191K C195R P199S I237M V254F T272A D285N % Freq CORP
1 E H A I L L P I Q R P I V A N 31.80 0.950
2 E H A I L L A I Q C P I V T D 25.50 0.950
3 E H E I L L P I Q R P I V A D 21.12 0.950
4 E H A I L L P I Q R P I V A D 9.37 0.950
5 E Y A I L L P I K C S I V A D 2.92 0.845
6 E H A I L I P I Q C P I V A D 2.53 0.652
7 E H A I L L P I K C P I V T D 2.00 0.950
8 E Y A I L L P I Q R P I V A D 0.92 0.845
9 E H A I L L P I K R P I V T D 0.84 0.950
10 E H A I L L P I K C P M V A D 0.38 0.950
11 E H A I L L P I Q C P I V A N 0.31 0.950
12 E H A I L L P I Q C P I V A D 0.31 0.950
13 E H A I L L A I Q R P I V T D 0.31 0.950
14 E H A I L L P I Q R P I F A N 0.15 0.967
15 E H A I L L P I Q C P I V T D 0.15 0.950
16 E H A I L L A I Q C S I V T D 0.08 0.950
17 E H A V L L P I Q R P I V A D 0.08 0.950
18 E H E I L L P N Q R P I V A D 0.08 0.950
19 E H E I L I P I Q R P I V A D 0.08 0.652
20 E H E I L L P I Q C P I V A D 0.08 0.950
21 E H E V L L P I Q C P I V A D 0.08 0.950
22 Q H A I L L P I Q R P I V A N 0.08 0.950
23 Q H E I L L P I Q R P I V A D 0.08 0.950
24 E H A I L L A I Q C P I V A D 0.08 0.950
25 E H A I L L A N Q C P I V T D 0.08 0.950
26 E H A I L L P I Q C P M V A D 0.08 0.950
27 E H E I L L A I Q C P I V T D 0.08 0.950
28 E H E I V L P I Q R P I V A D 0.08 0.950
29 E H E I L I A I Q C P I V T D 0.08 0.652
30 E H A V L L P I Q R P I V A N 0.08 0.950
31 E H A I L I P I Q C P I V A N 0.08 0.652
32 E H A I L L P I K C P I V A D 0.08 0.950
33 E H A I L L P I Q R P I V T D 0.08 0.950

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5H6.aApr07-unspliced main_exon 5UTR chr3 98,264,285 98,264,333 +
CDS chr3 98,264,333 98,265,259 +
3UTR chr3 98,265,259 98,265,262 +