Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5H7P Olfactory Receptor

Gene Symbol OR5H7P1 (View this gene in GeneCards)
Family 5
Subfamily H
Pseudogene Yes
CORP pseudogene probability score
Aliases OR3-6, HsOR3.3.10P, ORL3100
External Ids HGNC: 14771   GeneBank: AB065459, BK004589, NG_002228   ORDB: ORL3100   
Build #39 labels OR5H7P
Chromosomal location 3:98,238,352-98,239,278 (+)
Cluster 3@98
Synteny CLIC#9
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5H14 87.34% 308
OR5H6 89.64% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5H13 75% 308
Chimp CONTIG405.171-23594 96% 309
Mouse Or5h26 77% 308
Rat Or5h26 75% 308
Cow OR5H13 75% 308

Expression evidences

Source Accession
ESTs DV080100

Sequence information

Nucleotide sequence ATGGAGGAGGAAAATACAACATTGCTGACAGAGTTTGTTCTCACAGGATTTTTATATCAA
CCACAGTGGAAAATACCCCTGTTCCTGGCATTCTTGGTAATATAGCTCATCACCATCATG
GGGAATCTTGGTCTAATTGTTCTCATCTGGAAAGACCCTCACCTTCATATCCCAATGTAT
TTATTCCGTGGGAGTTTGGCCTTTGTGGATGCTTGGTTATCATCCACAGTGACTCCAAAG
ATGCTGATCAACTTCTTAGCTAAGAGTAAGATGATATCTCTCTCTGAATGCATGGTACAA
TTTTTTTCCTTTGTAATCAGTGTAACCACAGAATGTTTTATCTCGGCATCAATGGCATAT
GATCGCTATGTAGCCATTTGCAAAGCTTTACTTTATCCAGTCATTATGACCAACGGACTA
TGCATCCAGCTATTAGTCTTGTCATTTATAGGTGGCCTTCTTCATGCTTTAATCCATGAA
ATTTTTTTATTCAGATTAACCTTCTGTAATTCCAACATAATACAACACTTTTACTGTGAC
ATTATCCCATTGTTAAAGATTTCCTGTACTGATTCTTTTATTAACTTTCTAATGGTTTTT
ATTTTCGCAGATTCAATTCAAGTTTTTACCATTGGAACTATTCTTATATCTTATACACTT
GTCCTCCTTATAATCTTAAAAAATAAGTCTGTCAAAGGGATACAAAAAGCTGTCTCCACC
TGTGGAGCTCATCTCTTATCTGTATCTTTATACTATGGGCCCCTTGTCTTCATGTATGTG
GGCTCTGCATCCCCGCAAGCAGATGACCAAGATATGATGGAGTCTCTATTTTACACTGTC
ATCGTTCCTTTATTAAATTCCATGATCTACAGCCTGAGAAACAAGCAAGTAATAGCTTCA
TTCACAAAAATGTTCAAAAGAAATGTT
Conceptual translation MEEENTTLLTEFVLTGFLYQPQWKIPLFLAFLVIXITIMGNLGLIVLIWKDPHLHIPMY
LFRGSLAFVDAWLSSTVTPKMLINFLAKSKMISLSECMVQFFSFVISVTTECFISASMAY
DRYVAICKALLYPVIMTNGLCIQLLVLSFIGGLLHALIHEIFLFRLTFCNSNIIQHFYCD
IIPLLKISCTDSFINFLMVFIFADSIQVFTIGTILISYTLVLLIILKNKSVKGIQKAVST
CGAHLLSVSLYYGPLVFMYVGSASPQADDQDMMESLFYTVIVPLLNSMIYSLRNKQVIAS
FTKMFKRNV

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
3 97,957,609 97,957,611 mnp CGG/TGA rs71626325 (DbSNP)
3 97,957,718 97,957,718 SNP A/C rs72932879 (DbSNP)
3 97,957,349 97,957,349 SNP A/G rs6439722 (DbSNP)
3 97,957,490 97,957,490 SNP A/G rs6439724 (DbSNP)
3 97,957,611 97,957,611 SNP A/G rs34752089 (DbSNP)
3 97,957,961 97,957,961 SNP A/G rs72932882 (DbSNP)
3 97,957,580 97,957,580 SNP C/G rs7640735 (DbSNP)
3 97,958,054 97,958,054 SNP C/T rs9851509 (DbSNP)
3 97,957,609 97,957,609 SNP C/T rs7619376 (DbSNP)
3 97,957,473 97,957,473 SNP C/T rs7619253 (DbSNP)
3 97,957,539 97,957,539 SNP C/T rs6439725 (DbSNP)
3 97,957,730 97,957,730 SNP C/T rs72932881 (DbSNP)
3 97,958,115 97,958,115 SNP G/T rs73854556 (DbSNP)
3 98,238,765 98,238,765 SNP C/T 1000GP (CEU, CHBJPT)
3 98,238,767 98,238,767 SNP G/A 1000GP (CEU, CHBJPT)
3 98,239,210 98,239,210 SNP T/C 1000GP (CHBJPT)
3 100 -100 SNP C/T 1000GP (YRI, YRI, YRI, YRI, YRI)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.