Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5J1P Olfactory Receptor

Gene Symbol OR5J1P1 (View this gene in GeneCards)
Family 5
Subfamily J
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-169, HsOR11.11.43P, ORL3577
External Ids HGNC: 8348   GeneBank: AB065655, AB065842, AF179763, AF399354, BK004581, NG_004086   ORDB: ORL3577   
Build #39 labels OR5J1P
Chromosomal location 11:56,071,111-56,072,046 (+)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5J2 69.55% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5J1 89% 312
Mouse Or5j1 83% 309
Rat Or5j1 81% 309
Cow OR5J2 72% 313
Orang OR5G1 54% 310
Horse OR5J1 87% 308
Chimp OR5J1 97% 312

Expression evidences

Source Accession
mRNA AB529248
GNF Atlas2 gnf1h10663_at

Sequence information

Nucleotide sequence ATGGCTGATGTTAATTTTACATTGGTTACTGAGTTTATCCTTTTGGAACTGACAGATCGT
GCTGAACTGAAGATGGTCCTCTTCGTGTTGTTCCTGCTGATCTACACCATTTCCCTGGTG
GGAAATATAGGAATGCTCTTTCTAATCTATGTAACTCCCAAACTCCACACACCCATGTAT
TATTTCCTCAGCTGTCTGTCATTTGTTGATGCCTGCTATTCATCAGTTTTTGCACCCAGA
ATGCTGCTGAACTTCTTTGTTGAGCGGGAGACAATCTTATTCTCTGCATGTATTGTGCAG
TATTTTTTATTCGTGTCTCTCCTTACCACTGAGGGCTTCTTGCTGGCCACAATGGCTTAC
GACCGTTACATGGCCATTGTGAACCCTTTACTTTATACAGTAGCTATGACTAAAATAGTT
TGTATTGTGCTCGCATTTGGGTCATGTATGGGAGGTTTAATCAACTCATTGACACATACA
ATTGGCTTGGTGAAACTGTCTTTCTGTGGGCCAAATGTCATCAGTCACTTCTTCTGTGAT
CTTCCCCCACTGTTGAAGCTGTCATGTTCTGAGACATCTATGAATGAATTGTTGCTTTTG
ATCTTCTCTGGCATTATTGCCACGCTCACTTTTTTGACTGTGGTGATCTCCTACATCTTC
ATTGTTGCTGCTATCCTGAGGATCCGCTAAGCAGCAGGTAGACGTAAAGCCTTCTCCACC
TGCACCTCTCACCTGATTACCGTGACCTTATTCTATGGATCGATAAGCTTTAGTTACATT
CAGCCAAACTCCCAGTATTCCCTAGAACAAGAAAAGGTGGTGTCTGTATTTTATACCCTG
GTGGTTCCTATGTTAAACCCATTGATTTACAGCCTAAGGAACAAGGAAGTGAAGGAAGCT
GTGAAAAGGGCTATAGAAATGAAACATTTTCCTTGT
Conceptual translation MADVNFTLVTEFILLELTDRAELKMVLFVLFLLIYTISLVGNIGMLFLIYVTPKLHTPMY
YFLSCLSFVDACYSSVFAPRMLLNFFVERETILFSACIVQYFLFVSLLTTEGFLLATMAY
DRYMAIVNPLLYTVAMTKIVCIVLAFGSCMGGLINSLTHTIGLVKLSFCGPNVISHFFCD
LPPLLKLSCSETSMNELLLLIFSGIIATLTFLTVVISYIFIVAAILRIRXAGRRKAFST
CTSHLITVTLFYGSISFSYIQPNSQYSLEQEKVVSVFYTLVVPMLNPLIYSLRNKEVKEA
VKRAIEMKHFPC

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP G/C 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 55,838,821 55,838,821 SNP C/G rs61733261 (DbSNP)
11 55,838,825 55,838,825 SNP A/G rs61732559 (DbSNP)
11 55,838,851 55,838,851 SNP C/T rs61732554 (DbSNP)
11 55,838,868 55,838,868 SNP C/T rs17529415 (DbSNP)
11 55,838,899 55,838,899 SNP A/G rs61889271 (DbSNP)
11 55,838,953 55,838,953 SNP C/T rs61998212 (DbSNP)
11 55,839,018 55,839,018 SNP C/T rs17149970 (DbSNP)
11 55,839,036 55,839,035 Ins(1) -/G rs34288455 (DbSNP)
11 55,839,121 55,839,121 SNP C/T rs61910696 (DbSNP)
11 55,839,209 55,839,209 SNP C/T rs17529512 (DbSNP)
11 55,839,278 55,839,278 SNP A/C rs11227145 (DbSNP)
11 55,839,328 55,839,328 SNP A/G rs17529574 (DbSNP)
11 56,071,280 56,071,280 SNP C/T 1000GP (CHBJPT)
11 56,071,345 56,071,345 SNP C/G 1000GP (CEU)
11 56,071,349 56,071,349 SNP G/A 1000GP (CEU)
11 56,071,392 56,071,392 SNP C/T 1000GP (CEU)
11 56,071,423 56,071,423 SNP G/A 1000GP (CEU)
11 56,071,733 56,071,733 SNP C/T 1000GP (CEU)
11 56,071,795 56,071,795 SNP C/T 1000GP (CEU)
11 56,071,802 56,071,802 SNP C/A 1000GP (CEU, CHBJPT)
11 56,071,852 56,071,852 SNP G/A 1000GP (CEU)
11 56,071,927 56,071,927 SNP G/T 1000GP (CHBJPT)

Variations - CNVs

Chr Start End Type Sources
11 54,835,623 55,879,426 CopyNumber Variation_8690 (DGV)
11 55,685,799 55,842,512 CopyNumber Variation_9189 (DGV)
11 55,689,863 55,849,156 CopyNumber Variation_2927 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.