Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5J2 Olfactory Receptor

Gene Symbol OR5J21 (View this gene in GeneCards)
Family 5
Subfamily J
Pseudogene No
CORP pseudogene probability score 0.85 (pseudogene)
Aliases OR11-266, HsOR11.11.51
External Ids HGNC: 19612   GeneBank: AB065595, BK004517, HSHTPRHO2, NM_001005492   
Build #39 labels OR5J2
Chromosomal location 11:56,176,618-56,177,553 (+)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5J1P 69.55% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5J2 82% 312
Dog OR5J2B 83% 312
Chimp CONTIG970.9-1971 97% 312
Mouse Or5j3 78% 312
Rat Or5j1 68% 309
Cow OR5J2 77% 313

Expression evidences

Source Accession
mRNA AB528818
GNF Atlas2 gnf1h10906_at

Sequence information

Nucleotide sequence ATGGCTGATGATAATTTTACAGTTGTCACTGAGTTTATTCTTTTGGGATTGACAGATCAT
GCTGAACTAAAAGCTGTGCTTTTTGTGGTGTTCCTGGTGATTTACGCCATTACCTTGTTG
AGGAATCTGGGCATGATCCTCTTAATCCAAATCACCTCCAAACTCCACACACCCATGTAC
TTTTTACTCAGCTGTCTTTCATTTGTGGATGCCTGCTATTCATCTGCAATTGCACCCAAA
ATGCTGGTGAACCTCCTGGTTGTGAAGGCAACAATTTCTTTCTCTGCTTGCATGGTACAG
CATTTGTGTTTCGGAGTGTTCATCACCACAGAAGGCTTCTTACTGTCAGTGATGGCCTAT
GACCGCTATGTGGCCATTGTGAGTCCCTTGCTTTACACTGTAGCCATGTCTGATAGAAAG
TGTGTGGAGCTTGTCACAGGATCATGGATAGGTGGAATAGTTAACACATTAATCCACACA
ATCAGCTTGAGGAGACTGTCCTTTTGTAGGCTAAATGCTGTCAGCCACTTCTTCTGTGAC
ATTCCTTCACTGCTAAAGCTGTCATGTTCTGACACCTCCATGAATGAGTTGTTGCTGTTA
ACCTTCTCCGGAGTCATTGCCATGGCCACCTTCTTGACTGTGATCATTTCCTACATCTTC
ATTGCTTTTGCTAGCCTAAGGATCCACTCAGCATCAGGCAGACAGCAAGCCTTCTCCACC
TGTGCCTCTCACCTGACTGCTGTGACCATATTCTATGGTACCTTAATCTTTAGCTACATT
CAGCCAAGCTCCCAGTATTTTGTGGAACAAGAGAAAGTGGTTTCTATGTTCTATACGCTA
GGGATTCCCATGTTAAACCTGTTGATACACAGTTTGAGAAACAAGGACGTAAAGGAGGCA
GTGAAAAGGGCCATAGAAATGAAACATTTCCTCTGT
Conceptual translation MADDNFTVVTEFILLGLTDHAELKAVLFVVFLVIYAITLLRNLGMILLIQITSKLHTPMY
FLLSCLSFVDACYSSAIAPKMLVNLLVVKATISFSACMVQHLCFGVFITTEGFLLSVMAY
DRYVAIVSPLLYTVAMSDRKCVELVTGSWIGGIVNTLIHTISLRRLSFCRLNAVSHFFCD
IPSLLKLSCSDTSMNELLLLTFSGVIAMATFLTVIISYIFIAFASLRIHSASGRQQAFST
CASHLTAVTIFYGTLIFSYIQPSSQYFVEQEKVVSMFYTLGIPMLNLLIHSLRNKDVKEA
VKRAIEMKHFLC

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS G/C M/I 1000GP (YRI)
11 100 -100 SYN C/T Y/Y 1000GP (YRI, YRI)
11 55,944,251 55,944,250 Ins(1) -/C rs35524228 (DbSNP)
11 55,944,331 55,944,331 Del(1) -/A rs35777813 (DbSNP)
11 55,944,474 55,944,474 SYN A/G V/V rs4489763 (DbSNP)
11 55,944,501 55,944,501 NS C/G I/M rs12279899 (DbSNP)
11 56,176,998 56,176,998 SYN G/A V/V 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
11 55,943,994 55,947,029 Deletion #220 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

G16E M136I R139G % Freq CORP
1 G M R 96.39 0.910
2 G I R 2.63 0.934
3 G I G 0.66 0.934
4 E M R 0.33 0.910

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5J2.aApr07-unspliced main_exon CDS chr11 56,176,618 56,177,553 +
3UTR chr11 56,177,553 56,177,556 +