Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5J7P Olfactory Receptor

Gene Symbol OR5J7P1 (View this gene in GeneCards)
Family 5
Subfamily J
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR11.11.50P
External Ids HGNC: 31289   GeneBank: NG_004428   
Build #39 labels
Chromosomal location 11:56,165,500-56,165,921 (+)
Cluster 11@56
Synteny CLIC#26
Remarks Disrupted by Line repeat

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5J2 83.82% 136

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5J2B 85% 136
Dog OR5J2 85% 136
Chimp CONTIG970.9-12165 99% 140
Mouse Or5j3 79% 140
Rat Or5j1 77% 137
Cow OR5J2 81% 140

Sequence information

Nucleotide sequence GCATTTTTGCTGCATATTTCATTGATTATGTATCACTGCTAAAGCTGTCATGTTCTGACA
CCTCCATGAATGAGTTGTTGCTGTTAACCTTCTCTGGAGTCATTGCCACGGCCACCTTCT
TGATTGTGATCATTTCCTACATCTTCATTGCTTTTGCTATCCTAAGGATCTGCTCAGCAT
CAGGCAGACAGAAAGCCTTCTCCACCTGTGCCTCTAACCTAACTGCTATGGCCATATTCT
ACGGTACCTTAAGCTTTAGCTACATTCAGCCAAGCTCCCAGTATTCTGTGGAACAGGAGA
AAGTAGTTTCTGTGTTCTATACACTAGTGATTCCCATGTTAAACCCATTGATATACAGTC
TGAGAAACAAGGATGTAAAGCAGGCAGTGAAAAGAGCTATAGACATAAAACATTTCTCAT
GT
Conceptual translation IFAAYFIDYVSLLKLSCSDTSMNELLLLTFSGVIATATFLIVIISYIFIAFAILRICSAS
GRQKAFSTCASNLTAMAIFYGTLSFSYIQPSSQYSVEQEKVVSVFYTLVIPMLNPLIYSL
RNKDVKQAVKRAIDIKHFSC

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP C/T 1000GP (YRI)
11 55,933,084 55,933,084 SNP C/T rs12282595 (DbSNP)
11 56,165,608 56,165,608 SNP C/T 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 99 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.